Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KF68

Protein Details
Accession A0A5N6KF68    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-76ASKAYRMTPRKNRKGKERQQMNAQQSHydrophilic
NLS Segment(s)
PositionSequence
56-66RMTPRKNRKGK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MSINLPIERMLSRRRNGIVEYQVSAGYRIRIGRQRRGISSSSRALILHREASKAYRMTPRKNRKGKERQQMNAQQSKHEGYEWYERMDGTVQNEMSASIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.44
4 0.47
5 0.45
6 0.39
7 0.38
8 0.33
9 0.31
10 0.28
11 0.27
12 0.2
13 0.14
14 0.13
15 0.13
16 0.17
17 0.23
18 0.29
19 0.37
20 0.45
21 0.48
22 0.48
23 0.51
24 0.49
25 0.46
26 0.46
27 0.4
28 0.32
29 0.28
30 0.25
31 0.22
32 0.22
33 0.19
34 0.19
35 0.16
36 0.17
37 0.16
38 0.17
39 0.21
40 0.18
41 0.19
42 0.23
43 0.28
44 0.36
45 0.47
46 0.57
47 0.63
48 0.72
49 0.75
50 0.77
51 0.83
52 0.84
53 0.84
54 0.83
55 0.78
56 0.79
57 0.81
58 0.79
59 0.75
60 0.65
61 0.57
62 0.51
63 0.48
64 0.39
65 0.31
66 0.24
67 0.22
68 0.31
69 0.29
70 0.29
71 0.27
72 0.26
73 0.27
74 0.27
75 0.25
76 0.19
77 0.24
78 0.21
79 0.21
80 0.21