Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K3L1

Protein Details
Accession A0A5N6K3L1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-30NADRCRCYLKEREREREREKEKBasic
NLS Segment(s)
PositionSequence
26-28REK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPEAYMLMNADRCRCYLKEREREREREKEKKSGFPPVHRFELYHKIIQSLNFFFRLSLVTEINSEIPSINPLTATDDHAITTQIFSTTNSEVNQVLYLPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.35
4 0.44
5 0.51
6 0.59
7 0.69
8 0.72
9 0.8
10 0.81
11 0.82
12 0.8
13 0.79
14 0.75
15 0.74
16 0.7
17 0.69
18 0.65
19 0.65
20 0.61
21 0.6
22 0.64
23 0.58
24 0.59
25 0.51
26 0.49
27 0.43
28 0.47
29 0.41
30 0.36
31 0.31
32 0.27
33 0.28
34 0.29
35 0.27
36 0.2
37 0.18
38 0.16
39 0.16
40 0.14
41 0.13
42 0.13
43 0.11
44 0.11
45 0.1
46 0.09
47 0.1
48 0.11
49 0.11
50 0.1
51 0.09
52 0.07
53 0.07
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.12
60 0.12
61 0.16
62 0.15
63 0.15
64 0.16
65 0.16
66 0.16
67 0.12
68 0.12
69 0.09
70 0.09
71 0.09
72 0.1
73 0.13
74 0.14
75 0.17
76 0.17
77 0.18
78 0.18
79 0.19
80 0.18