Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6JWA8

Protein Details
Accession A0A5N6JWA8   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MYVPKSGRKSRHHPWRNLAHDHBasic
NLS Segment(s)
Subcellular Location(s) cyto 3.5, cyto_mito 9.5, mito 14.5, nucl 7
Family & Domain DBs
Amino Acid Sequences MYVPKSGRKSRHHPWRNLAHDHVLIQPIHTIALNMSNINYIIKYYLGLVNRLPLPQQDSLTSAGHLIKALLQVSGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.81
4 0.78
5 0.71
6 0.65
7 0.56
8 0.49
9 0.41
10 0.34
11 0.27
12 0.21
13 0.18
14 0.13
15 0.12
16 0.1
17 0.08
18 0.05
19 0.08
20 0.09
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.09
33 0.1
34 0.11
35 0.11
36 0.14
37 0.15
38 0.15
39 0.15
40 0.13
41 0.16
42 0.18
43 0.19
44 0.17
45 0.18
46 0.21
47 0.21
48 0.2
49 0.17
50 0.15
51 0.15
52 0.13
53 0.12
54 0.1
55 0.12
56 0.13