Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K1N4

Protein Details
Accession A0A5N6K1N4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-66RHKTPASPLKTRPKKNRTGSQGIKGYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 13.5, mito 7.5
Family & Domain DBs
Amino Acid Sequences MHTRYTQVLWEDLECTTTIQDFSISIESQKLLSCFEWQIFRHKTPASPLKTRPKKNRTGSQGIKGYLLVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.1
5 0.09
6 0.08
7 0.08
8 0.07
9 0.08
10 0.1
11 0.1
12 0.1
13 0.1
14 0.1
15 0.1
16 0.11
17 0.1
18 0.09
19 0.09
20 0.11
21 0.11
22 0.11
23 0.15
24 0.15
25 0.23
26 0.25
27 0.26
28 0.28
29 0.28
30 0.29
31 0.33
32 0.41
33 0.39
34 0.41
35 0.49
36 0.56
37 0.65
38 0.74
39 0.76
40 0.77
41 0.81
42 0.84
43 0.86
44 0.83
45 0.84
46 0.82
47 0.8
48 0.77
49 0.68
50 0.6
51 0.5