Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KL76

Protein Details
Accession A0A5N6KL76    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-51QNLKASKSKTQKSKNSRPPPKFSNHydrophilic
NLS Segment(s)
PositionSequence
31-46KASKSKTQKSKNSRPP
75-91KRKESHQRGTKEEEKKE
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MNPIISIPSSPPHHHIKIPISYKEGKPQNLKASKSKTQKSKNSRPPPKFSNQKIQLPLSPLKTSHEMCPSINPPKRKESHQRGTKEEEKKEGKKDTCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.44
4 0.48
5 0.52
6 0.5
7 0.47
8 0.49
9 0.49
10 0.52
11 0.51
12 0.49
13 0.49
14 0.52
15 0.57
16 0.58
17 0.6
18 0.58
19 0.6
20 0.62
21 0.64
22 0.65
23 0.65
24 0.68
25 0.74
26 0.76
27 0.79
28 0.82
29 0.84
30 0.87
31 0.84
32 0.81
33 0.78
34 0.77
35 0.75
36 0.68
37 0.68
38 0.64
39 0.63
40 0.6
41 0.56
42 0.49
43 0.44
44 0.43
45 0.36
46 0.31
47 0.26
48 0.25
49 0.27
50 0.27
51 0.26
52 0.29
53 0.27
54 0.26
55 0.31
56 0.33
57 0.39
58 0.43
59 0.45
60 0.44
61 0.51
62 0.54
63 0.57
64 0.63
65 0.64
66 0.69
67 0.72
68 0.75
69 0.71
70 0.76
71 0.77
72 0.75
73 0.69
74 0.67
75 0.68
76 0.68
77 0.7
78 0.72