Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1UZS8

Protein Details
Accession H1UZS8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
157-188EWTQKKVSSLKSKTSRKHTKEYNKARARYPSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
KEGG chig:CH63R_10911  -  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MSSSHYNSHYSLPMPVPSHKGQHYPGYGSTYSVSPPETDESVSSGTGPSYSNSGYSGGYSVANSSYAGSNSGDFESTHHSASGVDFNDYMQDRFAQTFDPIPLDRNIAVQAQTSGKLNAKHRELLELQKKAQARLAKTRERFNEGYRDAQDVRADLEWTQKKVSSLKSKTSRKHTKEYNKARARYPSPEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.34
4 0.34
5 0.39
6 0.38
7 0.41
8 0.39
9 0.44
10 0.44
11 0.41
12 0.4
13 0.4
14 0.37
15 0.33
16 0.3
17 0.23
18 0.21
19 0.18
20 0.17
21 0.11
22 0.14
23 0.15
24 0.15
25 0.15
26 0.15
27 0.16
28 0.16
29 0.16
30 0.13
31 0.11
32 0.1
33 0.09
34 0.1
35 0.08
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.1
42 0.1
43 0.1
44 0.09
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.09
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.08
61 0.09
62 0.14
63 0.15
64 0.15
65 0.13
66 0.13
67 0.13
68 0.14
69 0.16
70 0.11
71 0.1
72 0.1
73 0.09
74 0.12
75 0.13
76 0.12
77 0.08
78 0.08
79 0.08
80 0.09
81 0.09
82 0.07
83 0.07
84 0.08
85 0.09
86 0.1
87 0.1
88 0.11
89 0.12
90 0.13
91 0.12
92 0.11
93 0.12
94 0.11
95 0.11
96 0.09
97 0.1
98 0.1
99 0.1
100 0.1
101 0.11
102 0.13
103 0.18
104 0.23
105 0.27
106 0.29
107 0.32
108 0.32
109 0.35
110 0.34
111 0.39
112 0.42
113 0.4
114 0.38
115 0.39
116 0.39
117 0.36
118 0.38
119 0.33
120 0.3
121 0.36
122 0.43
123 0.48
124 0.51
125 0.58
126 0.57
127 0.6
128 0.58
129 0.52
130 0.53
131 0.47
132 0.49
133 0.43
134 0.43
135 0.37
136 0.37
137 0.34
138 0.24
139 0.24
140 0.19
141 0.19
142 0.14
143 0.23
144 0.25
145 0.26
146 0.28
147 0.28
148 0.29
149 0.34
150 0.42
151 0.43
152 0.44
153 0.52
154 0.61
155 0.68
156 0.74
157 0.8
158 0.82
159 0.78
160 0.83
161 0.83
162 0.84
163 0.86
164 0.89
165 0.89
166 0.87
167 0.85
168 0.82
169 0.81
170 0.76