Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K951

Protein Details
Accession A0A5N6K951   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-98FALPGQIARRRTKRKRVPCMHSLWEYHydrophilic
NLS Segment(s)
PositionSequence
81-87RRRTKRK
Subcellular Location(s) cyto 4.5, cyto_mito 11, mito 16.5, nucl 6
Family & Domain DBs
Amino Acid Sequences MHQSQRTRRERKLQVLLPIEAAEADLEVDEVEEEVEEVVDSEEVGAEAVEEVSKDWGRTNKNSEGRRLCWETFALPGQIARRRTKRKRVPCMHSLWEYWRFEWHIKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.73
3 0.65
4 0.56
5 0.46
6 0.36
7 0.26
8 0.21
9 0.12
10 0.06
11 0.05
12 0.04
13 0.04
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.02
34 0.02
35 0.03
36 0.03
37 0.03
38 0.03
39 0.05
40 0.05
41 0.06
42 0.08
43 0.12
44 0.16
45 0.2
46 0.25
47 0.32
48 0.4
49 0.42
50 0.48
51 0.49
52 0.49
53 0.52
54 0.52
55 0.43
56 0.37
57 0.36
58 0.29
59 0.26
60 0.24
61 0.18
62 0.13
63 0.14
64 0.17
65 0.22
66 0.26
67 0.32
68 0.4
69 0.51
70 0.61
71 0.7
72 0.76
73 0.82
74 0.88
75 0.9
76 0.88
77 0.86
78 0.84
79 0.8
80 0.73
81 0.66
82 0.61
83 0.59
84 0.54
85 0.46
86 0.43
87 0.4
88 0.4