Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K8V8

Protein Details
Accession A0A5N6K8V8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-38NKMPSTFKKHQKVVHQRKRLPKELLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9.5, plas 7, cyto_mito 6, pero 4, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYGSSFTFTDGWVNKMPSTFKKHQKVVHQRKRLPKELLLLFYTRNTATYFIWIFYLLVLDFPVLKIISSSFLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.29
4 0.29
5 0.37
6 0.42
7 0.48
8 0.55
9 0.6
10 0.64
11 0.71
12 0.76
13 0.78
14 0.8
15 0.8
16 0.78
17 0.82
18 0.84
19 0.8
20 0.73
21 0.64
22 0.6
23 0.53
24 0.49
25 0.4
26 0.33
27 0.26
28 0.22
29 0.21
30 0.14
31 0.12
32 0.11
33 0.11
34 0.11
35 0.14
36 0.14
37 0.13
38 0.14
39 0.13
40 0.12
41 0.1
42 0.11
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.08
50 0.07
51 0.07
52 0.07
53 0.08
54 0.13