Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KAZ4

Protein Details
Accession A0A5N6KAZ4    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
33-62LPSNGRKRCKIKCKLQTRMPRKKSYKLVDLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 12.5, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MSSCLASALVSSSLIINIHLLTSNAPFGRAPGLPSNGRKRCKIKCKLQTRMPRKKSYKLVDLLLRTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.06
6 0.07
7 0.07
8 0.07
9 0.07
10 0.1
11 0.09
12 0.1
13 0.09
14 0.1
15 0.12
16 0.11
17 0.13
18 0.13
19 0.17
20 0.19
21 0.24
22 0.34
23 0.39
24 0.42
25 0.46
26 0.5
27 0.56
28 0.64
29 0.69
30 0.69
31 0.72
32 0.8
33 0.83
34 0.85
35 0.87
36 0.87
37 0.89
38 0.86
39 0.87
40 0.83
41 0.83
42 0.84
43 0.81
44 0.79
45 0.72
46 0.71
47 0.68