Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KJN6

Protein Details
Accession A0A5N6KJN6   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-64AASARFRQKKKQREKSLEMSVKHydrophilic
NLS Segment(s)
PositionSequence
49-55RQKKKQR
Subcellular Location(s) mito 4, nucl 21
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
CDD cd14705  bZIP_Zip1  
Amino Acid Sequences MPMHQYLHTQPPPSAPLYAQAHSSPTQSLSPREPNAKRDASTAASARFRQKKKQREKSLEMSVKEQKERIGMMECRIKELEGENGFLKELVMGRIKWKEEKDNEENDNEEGKEKDDGKME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.23
3 0.27
4 0.3
5 0.3
6 0.28
7 0.25
8 0.27
9 0.26
10 0.27
11 0.2
12 0.17
13 0.2
14 0.2
15 0.23
16 0.26
17 0.31
18 0.34
19 0.42
20 0.43
21 0.44
22 0.49
23 0.48
24 0.43
25 0.39
26 0.38
27 0.31
28 0.31
29 0.29
30 0.25
31 0.25
32 0.26
33 0.32
34 0.37
35 0.38
36 0.45
37 0.52
38 0.59
39 0.67
40 0.76
41 0.79
42 0.79
43 0.83
44 0.8
45 0.81
46 0.76
47 0.66
48 0.6
49 0.55
50 0.48
51 0.42
52 0.36
53 0.26
54 0.22
55 0.22
56 0.18
57 0.18
58 0.17
59 0.2
60 0.25
61 0.24
62 0.25
63 0.25
64 0.23
65 0.18
66 0.19
67 0.22
68 0.18
69 0.2
70 0.18
71 0.18
72 0.18
73 0.17
74 0.15
75 0.09
76 0.09
77 0.09
78 0.12
79 0.12
80 0.17
81 0.22
82 0.24
83 0.29
84 0.33
85 0.39
86 0.43
87 0.52
88 0.54
89 0.57
90 0.57
91 0.54
92 0.52
93 0.45
94 0.41
95 0.33
96 0.29
97 0.22
98 0.21
99 0.24
100 0.23