Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KJB0

Protein Details
Accession A0A5N6KJB0   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-53QSRSRNTDCMPKKRKKERKKRKTPPIHSPFRIBasic
NLS Segment(s)
PositionSequence
33-45KKRKKERKKRKTP
Subcellular Location(s) cyto 4.5, cyto_mito 5, mito 4.5, nucl 16
Family & Domain DBs
Amino Acid Sequences MASMYHALPCFAYHAHYILETQSRSRNTDCMPKKRKKERKKRKTPPIHSPFRIPILFFLISIPPFPSPFHPIAHDETPSPCMHVYDTMTPPPSLMKSVHAANIPHMQRFEHRLLKSQLWSLERILFPSSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.15
5 0.15
6 0.2
7 0.18
8 0.2
9 0.25
10 0.27
11 0.3
12 0.31
13 0.33
14 0.31
15 0.41
16 0.47
17 0.51
18 0.59
19 0.64
20 0.73
21 0.8
22 0.88
23 0.88
24 0.91
25 0.91
26 0.93
27 0.95
28 0.96
29 0.96
30 0.96
31 0.93
32 0.93
33 0.91
34 0.89
35 0.8
36 0.74
37 0.65
38 0.59
39 0.51
40 0.4
41 0.31
42 0.26
43 0.24
44 0.18
45 0.16
46 0.13
47 0.12
48 0.12
49 0.12
50 0.08
51 0.08
52 0.09
53 0.1
54 0.13
55 0.15
56 0.15
57 0.17
58 0.19
59 0.22
60 0.23
61 0.22
62 0.18
63 0.18
64 0.2
65 0.18
66 0.16
67 0.12
68 0.11
69 0.11
70 0.12
71 0.14
72 0.16
73 0.18
74 0.2
75 0.21
76 0.21
77 0.2
78 0.2
79 0.18
80 0.15
81 0.14
82 0.14
83 0.16
84 0.18
85 0.2
86 0.22
87 0.21
88 0.23
89 0.3
90 0.29
91 0.28
92 0.27
93 0.26
94 0.26
95 0.32
96 0.35
97 0.35
98 0.35
99 0.41
100 0.45
101 0.49
102 0.49
103 0.47
104 0.46
105 0.4
106 0.41
107 0.36
108 0.38
109 0.33
110 0.32
111 0.3