Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KA88

Protein Details
Accession A0A5N6KA88   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MRKQGHKKKRKERWMMRSKGPRTMBasic
NLS Segment(s)
PositionSequence
3-20KQGHKKKRKERWMMRSKG
Subcellular Location(s) cyto_nucl 12.166, mito 6, mito_nucl 12.999, nucl 17.5
Family & Domain DBs
Amino Acid Sequences MRKQGHKKKRKERWMMRSKGPRTMFGLLGETFHHLNVNSKSTLRVYIITFDSCSEENIPLSNQDACPPESNGLLLSHNSRNGMKLQRLLDRVMVAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.9
3 0.89
4 0.89
5 0.81
6 0.79
7 0.7
8 0.63
9 0.57
10 0.53
11 0.44
12 0.34
13 0.34
14 0.25
15 0.23
16 0.2
17 0.17
18 0.14
19 0.12
20 0.12
21 0.09
22 0.14
23 0.15
24 0.18
25 0.17
26 0.17
27 0.18
28 0.18
29 0.19
30 0.15
31 0.15
32 0.12
33 0.14
34 0.15
35 0.14
36 0.14
37 0.12
38 0.13
39 0.11
40 0.12
41 0.1
42 0.1
43 0.09
44 0.1
45 0.1
46 0.09
47 0.1
48 0.1
49 0.09
50 0.12
51 0.14
52 0.15
53 0.17
54 0.18
55 0.18
56 0.17
57 0.17
58 0.15
59 0.14
60 0.13
61 0.13
62 0.15
63 0.17
64 0.19
65 0.21
66 0.2
67 0.21
68 0.26
69 0.32
70 0.32
71 0.35
72 0.38
73 0.43
74 0.45
75 0.46
76 0.43