Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6JYP6

Protein Details
Accession A0A5N6JYP6   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-43YVCLNRRQGRQDRQVQFKEKHydrophilic
47-116SIFGSPQQKKKTPKKIKPKRTYPNTLHQSHNSANQKEEKKKKRESERARERARKKERKKGRKETDRTTTRBasic
NLS Segment(s)
PositionSequence
55-66KKKTPKKIKPKR
82-108KEEKKKKRESERARERARKKERKKGRK
Subcellular Location(s) cyto_nucl 13.5, mito 3, nucl 21.5
Family & Domain DBs
Amino Acid Sequences MEHVQLAPYINDNTEVACTHVLMYVCLNRRQGRQDRQVQFKEKDIVSIFGSPQQKKKTPKKIKPKRTYPNTLHQSHNSANQKEEKKKKRESERARERARKKERKKGRKETDRTTTRTYYIRSPLLRLLVPHQKREDFNSSSSSSSSSSSPSASSYSYYHFTHSLTHSLTHYLSLTSLPILSTYYYCTGTRIISARITRTDLDNTSIGMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.12
5 0.12
6 0.11
7 0.14
8 0.13
9 0.12
10 0.15
11 0.19
12 0.24
13 0.28
14 0.33
15 0.34
16 0.39
17 0.48
18 0.55
19 0.58
20 0.63
21 0.7
22 0.72
23 0.78
24 0.81
25 0.79
26 0.72
27 0.67
28 0.64
29 0.53
30 0.5
31 0.41
32 0.36
33 0.29
34 0.29
35 0.24
36 0.24
37 0.31
38 0.29
39 0.34
40 0.39
41 0.45
42 0.53
43 0.63
44 0.68
45 0.72
46 0.8
47 0.84
48 0.88
49 0.92
50 0.93
51 0.93
52 0.93
53 0.91
54 0.91
55 0.85
56 0.84
57 0.81
58 0.74
59 0.67
60 0.59
61 0.55
62 0.47
63 0.49
64 0.45
65 0.38
66 0.37
67 0.41
68 0.46
69 0.5
70 0.58
71 0.59
72 0.61
73 0.69
74 0.75
75 0.78
76 0.82
77 0.84
78 0.85
79 0.86
80 0.87
81 0.87
82 0.87
83 0.83
84 0.83
85 0.83
86 0.83
87 0.8
88 0.8
89 0.82
90 0.84
91 0.89
92 0.89
93 0.89
94 0.89
95 0.87
96 0.85
97 0.84
98 0.79
99 0.74
100 0.68
101 0.58
102 0.5
103 0.46
104 0.41
105 0.35
106 0.33
107 0.34
108 0.29
109 0.29
110 0.29
111 0.28
112 0.27
113 0.23
114 0.23
115 0.28
116 0.3
117 0.32
118 0.34
119 0.35
120 0.35
121 0.4
122 0.42
123 0.35
124 0.34
125 0.34
126 0.33
127 0.3
128 0.29
129 0.25
130 0.19
131 0.17
132 0.16
133 0.14
134 0.13
135 0.13
136 0.13
137 0.13
138 0.13
139 0.13
140 0.14
141 0.13
142 0.16
143 0.19
144 0.19
145 0.2
146 0.2
147 0.2
148 0.22
149 0.23
150 0.24
151 0.21
152 0.22
153 0.21
154 0.22
155 0.22
156 0.19
157 0.17
158 0.13
159 0.12
160 0.11
161 0.11
162 0.09
163 0.09
164 0.07
165 0.07
166 0.08
167 0.08
168 0.09
169 0.11
170 0.13
171 0.16
172 0.16
173 0.17
174 0.18
175 0.18
176 0.22
177 0.21
178 0.22
179 0.26
180 0.29
181 0.32
182 0.34
183 0.36
184 0.34
185 0.34
186 0.37
187 0.32
188 0.33
189 0.29