Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6JYP6

Protein Details
Accession A0A5N6JYP6    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-43YVCLNRRQGRQDRQVQFKEKHydrophilic
47-116SIFGSPQQKKKTPKKIKPKRTYPNTLHQSHNSANQKEEKKKKRESERARERARKKERKKGRKETDRTTTRBasic
NLS Segment(s)
PositionSequence
55-66KKKTPKKIKPKR
82-108KEEKKKKRESERARERARKKERKKGRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
Amino Acid Sequences MEHVQLAPYINDNTEVACTHVLMYVCLNRRQGRQDRQVQFKEKDIVSIFGSPQQKKKTPKKIKPKRTYPNTLHQSHNSANQKEEKKKKRESERARERARKKERKKGRKETDRTTTRTYYIRSPLLRLLVPHQKREDFNSSSSSSSSSSSPSASSYSYYHFTHSLTHSLTHYLSLTSLPILSTYYYCTGTRIISARITRTDLDNTSIGMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.12
5 0.12
6 0.11
7 0.14
8 0.13
9 0.12
10 0.15
11 0.19
12 0.24
13 0.28
14 0.33
15 0.34
16 0.39
17 0.48
18 0.55
19 0.58
20 0.63
21 0.7
22 0.72
23 0.78
24 0.81
25 0.79
26 0.72
27 0.67
28 0.64
29 0.53
30 0.5
31 0.41
32 0.36
33 0.29
34 0.29
35 0.24
36 0.24
37 0.31
38 0.29
39 0.34
40 0.39
41 0.45
42 0.53
43 0.63
44 0.68
45 0.72
46 0.8
47 0.84
48 0.88
49 0.92
50 0.93
51 0.93
52 0.93
53 0.91
54 0.91
55 0.85
56 0.84
57 0.81
58 0.74
59 0.67
60 0.59
61 0.55
62 0.47
63 0.49
64 0.45
65 0.38
66 0.37
67 0.41
68 0.46
69 0.5
70 0.58
71 0.59
72 0.61
73 0.69
74 0.75
75 0.78
76 0.82
77 0.84
78 0.85
79 0.86
80 0.87
81 0.87
82 0.87
83 0.83
84 0.83
85 0.83
86 0.83
87 0.8
88 0.8
89 0.82
90 0.84
91 0.89
92 0.89
93 0.89
94 0.89
95 0.87
96 0.85
97 0.84
98 0.79
99 0.74
100 0.68
101 0.58
102 0.5
103 0.46
104 0.41
105 0.35
106 0.33
107 0.34
108 0.29
109 0.29
110 0.29
111 0.28
112 0.27
113 0.23
114 0.23
115 0.28
116 0.3
117 0.32
118 0.34
119 0.35
120 0.35
121 0.4
122 0.42
123 0.35
124 0.34
125 0.34
126 0.33
127 0.3
128 0.29
129 0.25
130 0.19
131 0.17
132 0.16
133 0.14
134 0.13
135 0.13
136 0.13
137 0.13
138 0.13
139 0.13
140 0.14
141 0.13
142 0.16
143 0.19
144 0.19
145 0.2
146 0.2
147 0.2
148 0.22
149 0.23
150 0.24
151 0.21
152 0.22
153 0.21
154 0.22
155 0.22
156 0.19
157 0.17
158 0.13
159 0.12
160 0.11
161 0.11
162 0.09
163 0.09
164 0.07
165 0.07
166 0.08
167 0.08
168 0.09
169 0.11
170 0.13
171 0.16
172 0.16
173 0.17
174 0.18
175 0.18
176 0.22
177 0.21
178 0.22
179 0.26
180 0.29
181 0.32
182 0.34
183 0.36
184 0.34
185 0.34
186 0.37
187 0.32
188 0.33
189 0.29