Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6JUB1

Protein Details
Accession A0A5N6JUB1   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
112-131IKKENKSKSLLRHQNPRKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4, cyto_mito 4.333, cyto_nucl 10.833, mito 3.5, nucl 16.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012588  Exosome-assoc_fac_Rrp6_N  
IPR045092  Rrp6-like  
Gene Ontology GO:0000176  C:nuclear exosome (RNase complex)  
GO:0000175  F:3'-5'-RNA exonuclease activity  
GO:0000467  P:exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF08066  PMC2NT  
Amino Acid Sequences MADDTQDFKSLQDEVQAALVSTIKTAGQISSEDLGFHRSLNPEVGNALDQQNARLIALANELLKSAGSVSGLKVPTLEDVDDVDNNWRNVVDVVDSLLEKTDTCLDEYTGIIKKENKSKSLLRHQNPRKDSLIILSAHKTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.15
4 0.13
5 0.12
6 0.13
7 0.09
8 0.09
9 0.09
10 0.07
11 0.07
12 0.08
13 0.08
14 0.08
15 0.09
16 0.11
17 0.12
18 0.12
19 0.12
20 0.11
21 0.14
22 0.13
23 0.13
24 0.13
25 0.13
26 0.14
27 0.16
28 0.16
29 0.13
30 0.13
31 0.14
32 0.12
33 0.12
34 0.11
35 0.12
36 0.11
37 0.11
38 0.13
39 0.12
40 0.11
41 0.1
42 0.1
43 0.07
44 0.08
45 0.09
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.04
54 0.05
55 0.05
56 0.05
57 0.1
58 0.1
59 0.1
60 0.1
61 0.1
62 0.1
63 0.11
64 0.1
65 0.06
66 0.07
67 0.08
68 0.08
69 0.08
70 0.11
71 0.13
72 0.13
73 0.13
74 0.11
75 0.11
76 0.11
77 0.11
78 0.09
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.07
88 0.1
89 0.1
90 0.12
91 0.12
92 0.12
93 0.13
94 0.14
95 0.16
96 0.17
97 0.17
98 0.19
99 0.23
100 0.28
101 0.36
102 0.4
103 0.39
104 0.41
105 0.47
106 0.54
107 0.6
108 0.66
109 0.64
110 0.71
111 0.77
112 0.82
113 0.79
114 0.75
115 0.68
116 0.59
117 0.53
118 0.47
119 0.43
120 0.34
121 0.34