Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KM84

Protein Details
Accession A0A5N6KM84    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
29-63DSMYLSQSKKREKKKKKKEKRKRRNNKSGRLVVGEBasic
NLS Segment(s)
PositionSequence
37-59KKREKKKKKKEKRKRRNNKSGRL
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MLEFTSPVWSKVEGLRLEIGNWKLKRQEDSMYLSQSKKREKKKKKKEKRKRRNNKSGRLVVGEKKIDEWSKYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.24
4 0.25
5 0.28
6 0.28
7 0.29
8 0.29
9 0.29
10 0.3
11 0.32
12 0.35
13 0.32
14 0.34
15 0.29
16 0.36
17 0.36
18 0.35
19 0.35
20 0.33
21 0.34
22 0.35
23 0.4
24 0.41
25 0.49
26 0.56
27 0.65
28 0.75
29 0.82
30 0.89
31 0.92
32 0.96
33 0.96
34 0.97
35 0.97
36 0.97
37 0.97
38 0.97
39 0.97
40 0.96
41 0.95
42 0.94
43 0.91
44 0.84
45 0.78
46 0.72
47 0.67
48 0.64
49 0.56
50 0.46
51 0.4
52 0.42
53 0.39