Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K8N1

Protein Details
Accession A0A5N6K8N1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
48-67SSQKDRKDYIRKPRQAYHQTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 6, cyto_nucl 11.5, mito 5, nucl 15
Family & Domain DBs
Amino Acid Sequences MIREIRKYSASCVLYIYDNDMNSSSPGPIFSCFRSPVHHFYIRRHISSSQKDRKDYIRKPRQAYHQTPFPIRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.25
4 0.19
5 0.18
6 0.18
7 0.17
8 0.16
9 0.15
10 0.16
11 0.11
12 0.08
13 0.09
14 0.09
15 0.1
16 0.11
17 0.12
18 0.15
19 0.17
20 0.17
21 0.21
22 0.24
23 0.27
24 0.31
25 0.36
26 0.34
27 0.36
28 0.46
29 0.45
30 0.42
31 0.4
32 0.38
33 0.4
34 0.49
35 0.56
36 0.55
37 0.57
38 0.59
39 0.59
40 0.65
41 0.67
42 0.66
43 0.67
44 0.68
45 0.7
46 0.75
47 0.79
48 0.8
49 0.8
50 0.79
51 0.76
52 0.73
53 0.71
54 0.68