Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K6T4

Protein Details
Accession A0A5N6K6T4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-62GMRGGDGKRERKKERKKERKKNTYCIYVIBasic
NLS Segment(s)
PositionSequence
23-54KGKGRFRVRGQGMRGGDGKRERKKERKKERKK
Subcellular Location(s) plas 8, nucl 5.5, mito 5, cyto_nucl 4, pero 3, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCLCIWYHLKNMNQDDELNCIAKGKGRFRVRGQGMRGGDGKRERKKERKKERKKNTYCIYVICICIYIYGFVHIVWTAMLYYVSISLGIECRIQRYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.36
4 0.34
5 0.26
6 0.22
7 0.18
8 0.17
9 0.19
10 0.24
11 0.25
12 0.32
13 0.37
14 0.43
15 0.46
16 0.56
17 0.58
18 0.59
19 0.56
20 0.55
21 0.49
22 0.46
23 0.45
24 0.36
25 0.34
26 0.34
27 0.4
28 0.4
29 0.48
30 0.53
31 0.6
32 0.7
33 0.77
34 0.81
35 0.84
36 0.88
37 0.91
38 0.94
39 0.95
40 0.92
41 0.91
42 0.87
43 0.83
44 0.73
45 0.63
46 0.56
47 0.47
48 0.39
49 0.29
50 0.23
51 0.15
52 0.14
53 0.13
54 0.09
55 0.07
56 0.08
57 0.08
58 0.07
59 0.08
60 0.08
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.05
72 0.05
73 0.06
74 0.07
75 0.09
76 0.12
77 0.12