Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q17Q79

Protein Details
Accession Q17Q79    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AKPTSNKNQIQQYKKRQTKLNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, E.R. 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016482  SecG/Sec61-beta/Sbh  
Gene Ontology GO:0016020  C:membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF03911  Sec61_beta  
Amino Acid Sequences MAKPTSNKNQIQQYKKRQTKLNELLYNQPSRLQISPMQVLVISLIFIANVFLLHILAKLVPSSSLPQAAIALMVVLLSIAFSFLSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.82
4 0.79
5 0.77
6 0.78
7 0.77
8 0.76
9 0.71
10 0.65
11 0.67
12 0.64
13 0.59
14 0.48
15 0.41
16 0.32
17 0.29
18 0.27
19 0.22
20 0.21
21 0.22
22 0.23
23 0.2
24 0.19
25 0.16
26 0.15
27 0.13
28 0.09
29 0.05
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.02
36 0.02
37 0.02
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.09
50 0.1
51 0.12
52 0.12
53 0.12
54 0.12
55 0.12
56 0.11
57 0.08
58 0.06
59 0.04
60 0.04
61 0.03
62 0.03
63 0.02
64 0.02
65 0.02
66 0.03
67 0.03