Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K418

Protein Details
Accession A0A5N6K418    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-103NIGIRRDPRIFRRRRRRPVRRRLRRLLPRPLAPWBasic
NLS Segment(s)
PositionSequence
74-98RRDPRIFRRRRRRPVRRRLRRLLPR
Subcellular Location(s) mito 14, nucl 9, pero 2
Family & Domain DBs
Amino Acid Sequences MADQTSTQQQREIPMANTGRRRAVLPILAFEQGYGWRFTGFRIPLVLNPVRAPLPLPAPPILPIPPILANIGIRRDPRIFRRRRRRPVRRRLRRLLPRPLAPWVSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.39
4 0.43
5 0.42
6 0.41
7 0.39
8 0.38
9 0.33
10 0.33
11 0.32
12 0.26
13 0.26
14 0.25
15 0.25
16 0.23
17 0.2
18 0.16
19 0.13
20 0.13
21 0.11
22 0.1
23 0.1
24 0.1
25 0.11
26 0.17
27 0.15
28 0.15
29 0.16
30 0.16
31 0.17
32 0.23
33 0.23
34 0.17
35 0.16
36 0.17
37 0.15
38 0.14
39 0.14
40 0.09
41 0.11
42 0.12
43 0.14
44 0.13
45 0.13
46 0.14
47 0.15
48 0.14
49 0.12
50 0.11
51 0.11
52 0.11
53 0.11
54 0.11
55 0.1
56 0.11
57 0.12
58 0.14
59 0.15
60 0.15
61 0.18
62 0.22
63 0.26
64 0.34
65 0.43
66 0.51
67 0.59
68 0.7
69 0.77
70 0.85
71 0.92
72 0.93
73 0.94
74 0.95
75 0.96
76 0.96
77 0.96
78 0.95
79 0.94
80 0.94
81 0.92
82 0.92
83 0.89
84 0.85
85 0.78
86 0.75