Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KJE2

Protein Details
Accession A0A5N6KJE2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-95RDQCKCGQPRKPTRPINSKKLPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 14, mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR006056  RidA  
IPR019897  RidA_CS  
IPR035959  RutC-like_sf  
IPR006175  YjgF/YER057c/UK114  
IPR001876  Znf_RanBP2  
IPR036443  Znf_RanBP2_sf  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01042  Ribonuc_L-PSP  
PROSITE View protein in PROSITE  
PS01094  UPF0076  
PS50199  ZF_RANBP2_2  
CDD cd00448  YjgF_YER057c_UK114_family  
Amino Acid Sequences MLSRTMFKHGATRLIGTSSRPSLTVTSMQSWTASNSWAFAASKPRTYKPKTLSQSFLKGDWNCPECGFHNFASRDQCKCGQPRKPTRPINSKKLPAPIGPYSHAMTTPTAVYVSGQLPVDLDGNLVEGTISEKTGTVLQNLSEVLSAAGSSLEKVFKVQVFLTDMKDLAEMNEEYEKWIKHKPARSCVAVKELPKGVDIEIECIATP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.28
4 0.31
5 0.28
6 0.26
7 0.24
8 0.25
9 0.23
10 0.25
11 0.28
12 0.25
13 0.26
14 0.26
15 0.26
16 0.25
17 0.24
18 0.23
19 0.18
20 0.17
21 0.13
22 0.13
23 0.13
24 0.14
25 0.14
26 0.14
27 0.22
28 0.23
29 0.3
30 0.33
31 0.39
32 0.46
33 0.51
34 0.58
35 0.54
36 0.62
37 0.63
38 0.64
39 0.65
40 0.61
41 0.63
42 0.56
43 0.52
44 0.49
45 0.42
46 0.4
47 0.41
48 0.37
49 0.3
50 0.29
51 0.29
52 0.24
53 0.27
54 0.26
55 0.2
56 0.26
57 0.26
58 0.29
59 0.35
60 0.36
61 0.34
62 0.34
63 0.37
64 0.35
65 0.41
66 0.47
67 0.46
68 0.54
69 0.63
70 0.69
71 0.75
72 0.78
73 0.79
74 0.82
75 0.81
76 0.81
77 0.77
78 0.73
79 0.66
80 0.63
81 0.56
82 0.46
83 0.45
84 0.38
85 0.32
86 0.29
87 0.28
88 0.23
89 0.21
90 0.2
91 0.15
92 0.13
93 0.11
94 0.09
95 0.07
96 0.06
97 0.06
98 0.06
99 0.07
100 0.07
101 0.08
102 0.08
103 0.07
104 0.07
105 0.08
106 0.09
107 0.07
108 0.06
109 0.04
110 0.05
111 0.05
112 0.05
113 0.04
114 0.03
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.09
122 0.1
123 0.1
124 0.1
125 0.1
126 0.11
127 0.11
128 0.11
129 0.08
130 0.07
131 0.06
132 0.05
133 0.05
134 0.04
135 0.04
136 0.04
137 0.05
138 0.06
139 0.06
140 0.06
141 0.08
142 0.1
143 0.11
144 0.13
145 0.13
146 0.14
147 0.19
148 0.2
149 0.22
150 0.21
151 0.2
152 0.18
153 0.18
154 0.15
155 0.11
156 0.13
157 0.11
158 0.12
159 0.15
160 0.14
161 0.16
162 0.21
163 0.21
164 0.2
165 0.27
166 0.33
167 0.38
168 0.47
169 0.53
170 0.59
171 0.65
172 0.69
173 0.67
174 0.63
175 0.63
176 0.6
177 0.53
178 0.5
179 0.47
180 0.41
181 0.37
182 0.35
183 0.27
184 0.27
185 0.26
186 0.22
187 0.19