Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KA10

Protein Details
Accession A0A5N6KA10    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSSNISRKERRKKQTRLTFDSISHydrophilic
NLS Segment(s)
PositionSequence
83-84KK
Subcellular Location(s) mito 18.5, cyto_mito 10.333, nucl 7.5, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MSSSNISRKERRKKQTRLTFDSISAEVPAGSPAKNQGPSPAKVRYEKVSGGASMGNGGRVTRSGKSSGSPFKASFGINGKSGKKVKDGKINFGTSPTPAKKLPER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.92
4 0.89
5 0.86
6 0.77
7 0.69
8 0.61
9 0.51
10 0.4
11 0.31
12 0.22
13 0.14
14 0.12
15 0.11
16 0.09
17 0.08
18 0.08
19 0.11
20 0.15
21 0.17
22 0.16
23 0.23
24 0.27
25 0.29
26 0.33
27 0.36
28 0.35
29 0.37
30 0.39
31 0.34
32 0.33
33 0.31
34 0.29
35 0.24
36 0.2
37 0.18
38 0.16
39 0.12
40 0.1
41 0.09
42 0.07
43 0.06
44 0.06
45 0.05
46 0.06
47 0.09
48 0.09
49 0.11
50 0.13
51 0.13
52 0.16
53 0.21
54 0.27
55 0.29
56 0.31
57 0.29
58 0.29
59 0.31
60 0.29
61 0.27
62 0.26
63 0.24
64 0.24
65 0.28
66 0.27
67 0.33
68 0.36
69 0.35
70 0.38
71 0.44
72 0.48
73 0.54
74 0.56
75 0.58
76 0.62
77 0.63
78 0.56
79 0.51
80 0.45
81 0.37
82 0.43
83 0.36
84 0.33
85 0.32