Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I7L4D8

Protein Details
Accession I7L4D8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-84IPSWRFYRRNPLKFRAPVKDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, E.R. 6, mito 4, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MYRSFLSKIDPPIDYVGQKLASDLMYLIFGVGYTAAFVAGVLFNDLVYTMYISIATLVISVIIVIPSWRFYRRNPLKFRAPVKDKED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.23
4 0.2
5 0.2
6 0.17
7 0.14
8 0.12
9 0.11
10 0.1
11 0.08
12 0.06
13 0.06
14 0.06
15 0.04
16 0.04
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.07
54 0.09
55 0.14
56 0.16
57 0.19
58 0.31
59 0.41
60 0.51
61 0.57
62 0.62
63 0.68
64 0.75
65 0.8
66 0.8
67 0.76