Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6JT26

Protein Details
Accession A0A5N6JT26    Localization Confidence High Confidence Score 21.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-95GESYRPNHNRRSPPRADTFRSDRDRDRSPRRDRRTPPLSSDSYHPGGRDRSPRRRSRTPPYRARDRSPPRDMNBasic
108-155RTPLRARSPRRFSPRRDDDRRERPRSPRRDDRRRSRSPFDRNRTPLRABasic
171-190PPPGPRGSWRPRSRSRDPRDBasic
505-528REELKQKQEKLRKGLKHWDRLSREBasic
NLS Segment(s)
PositionSequence
45-59RDRDRSPRRDRRTPP
66-225HPGGRDRSPRRRSRTPPYRARDRSPPRDMNWRGRARSPIRGGRTPLRARSPRRFSPRRDDDRRERPRSPRRDDRRRSRSPFDRNRTPLRARSPIIRARSPLPRRSPPPGPRGSWRPRSRSRDPRDVRTPIGPSSQTWRRRSPSPIRRRSPSPIRRRSPSP
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MERGRDRRIDIRGDGEVTRLGAGESYRPNHNRRSPPRADTFRSDRDRDRSPRRDRRTPPLSSDSYHPGGRDRSPRRRSRTPPYRARDRSPPRDMNWRGRARSPIRGGRTPLRARSPRRFSPRRDDDRRERPRSPRRDDRRRSRSPFDRNRTPLRARSPIIRARSPLPRRSPPPGPRGSWRPRSRSRDPRDVRTPIGPSSQTWRRRSPSPIRRRSPSPIRRRSPSPALRDSERSSGRSSGTNSPTREAIRSPVPTRDRSPSSLAYRQREQESARSTPKDRSPIRPTAPRSPPRGPAATFRGPETTFRAPTGPSGSRNFTAPIPSGPSSYNSRSGSESNGSIAPPSGPRGYAPPRGPSTSFRGGRSSFSTDRHNRPDTSSWGAAPPARPSADLSSRTSLPPPRPPPSVSPSPARDTPPAAPTGPSGIPTGPRAGTTVASRPSLQHSSSIYHSRGSISGPSSGPRIHPAMVGIPPILPGGRIDPTVSGISADIAARLKKKEEEAEVLREELKQKQEKLRKGLKHWDRLSRESASMGLKSELSERHLRVLAGEGVGGKAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.35
3 0.3
4 0.24
5 0.21
6 0.16
7 0.12
8 0.11
9 0.12
10 0.16
11 0.21
12 0.23
13 0.32
14 0.38
15 0.43
16 0.51
17 0.6
18 0.65
19 0.69
20 0.76
21 0.75
22 0.77
23 0.83
24 0.82
25 0.78
26 0.76
27 0.75
28 0.75
29 0.74
30 0.72
31 0.69
32 0.66
33 0.7
34 0.71
35 0.73
36 0.74
37 0.77
38 0.83
39 0.84
40 0.88
41 0.86
42 0.87
43 0.85
44 0.81
45 0.78
46 0.75
47 0.7
48 0.62
49 0.59
50 0.55
51 0.5
52 0.45
53 0.38
54 0.34
55 0.35
56 0.39
57 0.45
58 0.48
59 0.55
60 0.64
61 0.73
62 0.77
63 0.83
64 0.85
65 0.86
66 0.86
67 0.86
68 0.87
69 0.86
70 0.88
71 0.84
72 0.82
73 0.82
74 0.81
75 0.81
76 0.8
77 0.79
78 0.72
79 0.76
80 0.76
81 0.75
82 0.75
83 0.73
84 0.67
85 0.64
86 0.7
87 0.64
88 0.66
89 0.65
90 0.63
91 0.61
92 0.63
93 0.64
94 0.62
95 0.67
96 0.64
97 0.62
98 0.64
99 0.65
100 0.68
101 0.73
102 0.74
103 0.74
104 0.78
105 0.8
106 0.77
107 0.8
108 0.82
109 0.82
110 0.83
111 0.83
112 0.83
113 0.86
114 0.89
115 0.86
116 0.83
117 0.83
118 0.84
119 0.85
120 0.84
121 0.84
122 0.84
123 0.87
124 0.9
125 0.91
126 0.91
127 0.91
128 0.89
129 0.88
130 0.87
131 0.87
132 0.87
133 0.85
134 0.85
135 0.81
136 0.82
137 0.8
138 0.76
139 0.72
140 0.69
141 0.67
142 0.58
143 0.58
144 0.58
145 0.56
146 0.56
147 0.52
148 0.47
149 0.45
150 0.53
151 0.54
152 0.54
153 0.55
154 0.57
155 0.6
156 0.64
157 0.69
158 0.67
159 0.69
160 0.67
161 0.62
162 0.61
163 0.66
164 0.67
165 0.68
166 0.68
167 0.67
168 0.71
169 0.76
170 0.79
171 0.8
172 0.79
173 0.8
174 0.78
175 0.78
176 0.77
177 0.72
178 0.65
179 0.59
180 0.53
181 0.44
182 0.43
183 0.35
184 0.27
185 0.3
186 0.36
187 0.4
188 0.42
189 0.47
190 0.47
191 0.51
192 0.59
193 0.62
194 0.64
195 0.67
196 0.73
197 0.72
198 0.74
199 0.74
200 0.74
201 0.74
202 0.74
203 0.74
204 0.74
205 0.74
206 0.74
207 0.74
208 0.72
209 0.71
210 0.69
211 0.65
212 0.61
213 0.58
214 0.56
215 0.55
216 0.51
217 0.48
218 0.42
219 0.37
220 0.32
221 0.31
222 0.29
223 0.27
224 0.28
225 0.28
226 0.32
227 0.36
228 0.34
229 0.34
230 0.35
231 0.33
232 0.31
233 0.24
234 0.21
235 0.2
236 0.24
237 0.24
238 0.29
239 0.32
240 0.34
241 0.36
242 0.39
243 0.37
244 0.36
245 0.38
246 0.36
247 0.38
248 0.42
249 0.45
250 0.43
251 0.43
252 0.43
253 0.41
254 0.39
255 0.35
256 0.34
257 0.33
258 0.33
259 0.34
260 0.34
261 0.33
262 0.35
263 0.38
264 0.4
265 0.39
266 0.42
267 0.45
268 0.5
269 0.52
270 0.55
271 0.56
272 0.57
273 0.63
274 0.61
275 0.61
276 0.57
277 0.58
278 0.54
279 0.52
280 0.44
281 0.4
282 0.41
283 0.39
284 0.36
285 0.32
286 0.31
287 0.28
288 0.29
289 0.29
290 0.26
291 0.21
292 0.21
293 0.21
294 0.18
295 0.19
296 0.24
297 0.2
298 0.2
299 0.22
300 0.24
301 0.24
302 0.24
303 0.24
304 0.19
305 0.19
306 0.17
307 0.15
308 0.17
309 0.17
310 0.17
311 0.16
312 0.19
313 0.21
314 0.23
315 0.28
316 0.25
317 0.26
318 0.27
319 0.27
320 0.27
321 0.24
322 0.22
323 0.17
324 0.17
325 0.15
326 0.13
327 0.12
328 0.1
329 0.09
330 0.11
331 0.1
332 0.09
333 0.1
334 0.16
335 0.21
336 0.28
337 0.29
338 0.33
339 0.35
340 0.38
341 0.39
342 0.37
343 0.39
344 0.41
345 0.41
346 0.37
347 0.39
348 0.37
349 0.38
350 0.39
351 0.38
352 0.32
353 0.32
354 0.39
355 0.42
356 0.48
357 0.53
358 0.53
359 0.47
360 0.49
361 0.51
362 0.46
363 0.45
364 0.39
365 0.32
366 0.29
367 0.29
368 0.27
369 0.23
370 0.21
371 0.19
372 0.18
373 0.18
374 0.19
375 0.24
376 0.28
377 0.3
378 0.31
379 0.31
380 0.32
381 0.32
382 0.34
383 0.34
384 0.33
385 0.4
386 0.43
387 0.45
388 0.47
389 0.49
390 0.51
391 0.53
392 0.56
393 0.49
394 0.49
395 0.48
396 0.5
397 0.51
398 0.48
399 0.43
400 0.39
401 0.39
402 0.35
403 0.33
404 0.28
405 0.25
406 0.22
407 0.24
408 0.21
409 0.18
410 0.17
411 0.15
412 0.17
413 0.17
414 0.2
415 0.15
416 0.15
417 0.16
418 0.15
419 0.16
420 0.17
421 0.21
422 0.21
423 0.23
424 0.23
425 0.23
426 0.28
427 0.3
428 0.28
429 0.27
430 0.26
431 0.27
432 0.32
433 0.36
434 0.31
435 0.28
436 0.28
437 0.26
438 0.24
439 0.23
440 0.23
441 0.18
442 0.22
443 0.21
444 0.22
445 0.23
446 0.23
447 0.23
448 0.22
449 0.23
450 0.2
451 0.2
452 0.2
453 0.21
454 0.21
455 0.21
456 0.17
457 0.15
458 0.14
459 0.14
460 0.13
461 0.09
462 0.08
463 0.1
464 0.12
465 0.13
466 0.13
467 0.13
468 0.16
469 0.17
470 0.16
471 0.13
472 0.11
473 0.11
474 0.11
475 0.11
476 0.1
477 0.11
478 0.15
479 0.18
480 0.2
481 0.23
482 0.26
483 0.31
484 0.35
485 0.38
486 0.43
487 0.45
488 0.49
489 0.47
490 0.45
491 0.41
492 0.37
493 0.35
494 0.32
495 0.36
496 0.37
497 0.42
498 0.51
499 0.6
500 0.66
501 0.73
502 0.77
503 0.76
504 0.77
505 0.82
506 0.81
507 0.82
508 0.81
509 0.81
510 0.78
511 0.75
512 0.73
513 0.66
514 0.57
515 0.48
516 0.44
517 0.38
518 0.32
519 0.29
520 0.25
521 0.21
522 0.21
523 0.24
524 0.23
525 0.25
526 0.31
527 0.31
528 0.35
529 0.37
530 0.36
531 0.32
532 0.34
533 0.31
534 0.24
535 0.23
536 0.18