Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KK51

Protein Details
Accession A0A5N6KK51    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-33KEDFRYKSKNKDEDKNKDRDRBasic
NLS Segment(s)
PositionSequence
31-36RDRGGR
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MNLITNRRCNIIKEDFRYKSKNKDEDKNKDRDRGGRKDRERYEGYLPSSIPIFPSNSHIQLKSKPYPHPDKESSRISPQYSTETNNHISNRYGIEENSVITDRKPQSYHMWKKIEIDIKKPYTDEANL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.65
4 0.69
5 0.66
6 0.66
7 0.67
8 0.7
9 0.67
10 0.71
11 0.76
12 0.79
13 0.82
14 0.83
15 0.78
16 0.76
17 0.72
18 0.71
19 0.69
20 0.68
21 0.7
22 0.7
23 0.71
24 0.74
25 0.74
26 0.73
27 0.67
28 0.61
29 0.57
30 0.52
31 0.47
32 0.4
33 0.36
34 0.29
35 0.26
36 0.22
37 0.16
38 0.12
39 0.11
40 0.09
41 0.14
42 0.16
43 0.19
44 0.21
45 0.21
46 0.22
47 0.25
48 0.31
49 0.31
50 0.33
51 0.33
52 0.39
53 0.47
54 0.49
55 0.52
56 0.51
57 0.52
58 0.53
59 0.55
60 0.51
61 0.48
62 0.47
63 0.41
64 0.37
65 0.33
66 0.32
67 0.28
68 0.29
69 0.26
70 0.26
71 0.27
72 0.29
73 0.29
74 0.25
75 0.25
76 0.23
77 0.22
78 0.21
79 0.19
80 0.16
81 0.18
82 0.17
83 0.16
84 0.17
85 0.17
86 0.14
87 0.13
88 0.22
89 0.21
90 0.25
91 0.26
92 0.27
93 0.36
94 0.47
95 0.57
96 0.57
97 0.61
98 0.58
99 0.61
100 0.65
101 0.64
102 0.57
103 0.53
104 0.54
105 0.53
106 0.53
107 0.5
108 0.44