Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V7B4

Protein Details
Accession H1V7B4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-52VLCCYCCCFRNKRKQQRGRQAHPVGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, mito 6, plas 6, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG chig:CH63R_01769  -  
Amino Acid Sequences MAGRGRRLATGAIVGIAIAGFLFIAFWVLCCYCCCFRNKRKQQRGRQAHPVGGGGGGMFSRFMPGRQRQGPGMMESGYGHGHGHHHGVAQPAPSHGYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.05
5 0.03
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.03
12 0.03
13 0.04
14 0.06
15 0.06
16 0.07
17 0.08
18 0.13
19 0.15
20 0.18
21 0.22
22 0.3
23 0.39
24 0.5
25 0.6
26 0.68
27 0.76
28 0.83
29 0.89
30 0.91
31 0.92
32 0.87
33 0.86
34 0.78
35 0.68
36 0.59
37 0.49
38 0.37
39 0.27
40 0.2
41 0.09
42 0.07
43 0.04
44 0.03
45 0.03
46 0.03
47 0.05
48 0.05
49 0.07
50 0.14
51 0.19
52 0.27
53 0.31
54 0.34
55 0.33
56 0.38
57 0.38
58 0.33
59 0.3
60 0.23
61 0.2
62 0.17
63 0.18
64 0.13
65 0.12
66 0.1
67 0.09
68 0.1
69 0.11
70 0.13
71 0.13
72 0.14
73 0.15
74 0.19
75 0.2
76 0.22
77 0.21
78 0.2