Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K218

Protein Details
Accession A0A5N6K218    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-47ILNVPLTKKERERKREKKRERERERERKRERERERERERERERERBasic
NLS Segment(s)
PositionSequence
10-80KKERERKREKKRERERERERKREREREREREREREREREREREKREEREREREREEREREREKREERREKR
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MVILNVPLTKKERERKREKKRERERERERKREREREREREREREREREREREKREEREREREREEREREREKREERREKREIYIYISLSTYINLSKAHVNGTNPVVSEHTKIKIHSQLPSRVIPPILLYKFAQGFPLNAKATSTIDITP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.86
4 0.91
5 0.93
6 0.95
7 0.95
8 0.96
9 0.95
10 0.95
11 0.95
12 0.95
13 0.95
14 0.95
15 0.93
16 0.93
17 0.93
18 0.92
19 0.91
20 0.9
21 0.9
22 0.9
23 0.9
24 0.9
25 0.85
26 0.85
27 0.82
28 0.81
29 0.77
30 0.77
31 0.74
32 0.74
33 0.74
34 0.74
35 0.76
36 0.75
37 0.75
38 0.75
39 0.75
40 0.74
41 0.78
42 0.78
43 0.76
44 0.77
45 0.77
46 0.73
47 0.73
48 0.69
49 0.65
50 0.64
51 0.64
52 0.62
53 0.62
54 0.66
55 0.64
56 0.65
57 0.67
58 0.65
59 0.69
60 0.71
61 0.74
62 0.72
63 0.76
64 0.76
65 0.71
66 0.67
67 0.62
68 0.53
69 0.47
70 0.45
71 0.36
72 0.3
73 0.27
74 0.24
75 0.18
76 0.16
77 0.12
78 0.07
79 0.08
80 0.07
81 0.08
82 0.1
83 0.1
84 0.13
85 0.15
86 0.15
87 0.17
88 0.19
89 0.19
90 0.17
91 0.17
92 0.17
93 0.16
94 0.18
95 0.18
96 0.2
97 0.21
98 0.22
99 0.26
100 0.32
101 0.33
102 0.36
103 0.4
104 0.43
105 0.45
106 0.48
107 0.43
108 0.38
109 0.36
110 0.3
111 0.27
112 0.28
113 0.25
114 0.25
115 0.24
116 0.26
117 0.28
118 0.28
119 0.29
120 0.21
121 0.22
122 0.23
123 0.3
124 0.27
125 0.25
126 0.26
127 0.24
128 0.26
129 0.26