Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K218

Protein Details
Accession A0A5N6K218   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-47ILNVPLTKKERERKREKKRERERERERKRERERERERERERERERBasic
NLS Segment(s)
PositionSequence
10-80KKERERKREKKRERERERERKREREREREREREREREREREREKREEREREREREEREREREKREERREKR
Subcellular Location(s) cyto_nucl 11.5, mito 6, nucl 20
Family & Domain DBs
Amino Acid Sequences MVILNVPLTKKERERKREKKRERERERERKREREREREREREREREREREREKREEREREREREEREREREKREERREKREIYIYISLSTYINLSKAHVNGTNPVVSEHTKIKIHSQLPSRVIPPILLYKFAQGFPLNAKATSTIDITP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.86
4 0.91
5 0.93
6 0.95
7 0.95
8 0.96
9 0.95
10 0.95
11 0.95
12 0.95
13 0.95
14 0.95
15 0.93
16 0.93
17 0.93
18 0.92
19 0.91
20 0.9
21 0.9
22 0.9
23 0.9
24 0.9
25 0.85
26 0.85
27 0.82
28 0.81
29 0.77
30 0.77
31 0.74
32 0.74
33 0.74
34 0.74
35 0.76
36 0.75
37 0.75
38 0.75
39 0.75
40 0.74
41 0.78
42 0.78
43 0.76
44 0.77
45 0.77
46 0.73
47 0.73
48 0.69
49 0.65
50 0.64
51 0.64
52 0.62
53 0.62
54 0.66
55 0.64
56 0.65
57 0.67
58 0.65
59 0.69
60 0.71
61 0.74
62 0.72
63 0.76
64 0.76
65 0.71
66 0.67
67 0.62
68 0.53
69 0.47
70 0.45
71 0.36
72 0.3
73 0.27
74 0.24
75 0.18
76 0.16
77 0.12
78 0.07
79 0.08
80 0.07
81 0.08
82 0.1
83 0.1
84 0.13
85 0.15
86 0.15
87 0.17
88 0.19
89 0.19
90 0.17
91 0.17
92 0.17
93 0.16
94 0.18
95 0.18
96 0.2
97 0.21
98 0.22
99 0.26
100 0.32
101 0.33
102 0.36
103 0.4
104 0.43
105 0.45
106 0.48
107 0.43
108 0.38
109 0.36
110 0.3
111 0.27
112 0.28
113 0.25
114 0.25
115 0.24
116 0.26
117 0.28
118 0.28
119 0.29
120 0.21
121 0.22
122 0.23
123 0.3
124 0.27
125 0.25
126 0.26
127 0.24
128 0.26
129 0.26