Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KB09

Protein Details
Accession A0A5N6KB09   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
181-208NSSNGEKKRKPGKKMRIILRERRRKSQABasic
215-250KEKESKEQAERERRARKNREKKVRRKAKEQALKAAABasic
NLS Segment(s)
PositionSequence
186-243EKKRKPGKKMRIILRERRRKSQAQDEAIAKEKESKEQAERERRARKNREKKVRRKAKE
Subcellular Location(s) cyto 4.5, cyto_nucl 13.333, mito_nucl 11.833, nucl 21
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFDLPDAKRVRRSDLYNRSSSSSPEPSSPIDPNASARFHEQLASLYGIIPHQLYATESVLKPEPNNDAPHLLPPKDSQDQEEEFDFRLFSNGKESKIVLKEDIADKGVFVVKERNKSYYFTGLIEGKRKEEYAIAAISGEDVSQGRKQRYWGLEVPWRVRVLKVGIGGQKVVGNNGLAVCNSSNGEKKRKPGKKMRIILRERRRKSQAQDEAIAKEKESKEQAERERRARKNREKKVRRKAKEQALKAAAGGLDQMGPGVDRGVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.66
4 0.66
5 0.62
6 0.56
7 0.52
8 0.48
9 0.44
10 0.39
11 0.36
12 0.37
13 0.36
14 0.39
15 0.38
16 0.34
17 0.29
18 0.29
19 0.31
20 0.32
21 0.3
22 0.27
23 0.27
24 0.27
25 0.24
26 0.24
27 0.2
28 0.17
29 0.18
30 0.18
31 0.15
32 0.13
33 0.13
34 0.12
35 0.12
36 0.1
37 0.08
38 0.07
39 0.07
40 0.07
41 0.1
42 0.11
43 0.14
44 0.14
45 0.17
46 0.19
47 0.2
48 0.19
49 0.2
50 0.24
51 0.24
52 0.27
53 0.26
54 0.27
55 0.26
56 0.33
57 0.34
58 0.29
59 0.27
60 0.26
61 0.3
62 0.32
63 0.32
64 0.27
65 0.29
66 0.3
67 0.31
68 0.3
69 0.25
70 0.21
71 0.21
72 0.18
73 0.13
74 0.14
75 0.12
76 0.11
77 0.18
78 0.19
79 0.2
80 0.21
81 0.22
82 0.25
83 0.28
84 0.29
85 0.2
86 0.19
87 0.2
88 0.21
89 0.21
90 0.17
91 0.14
92 0.12
93 0.12
94 0.13
95 0.11
96 0.1
97 0.17
98 0.19
99 0.26
100 0.27
101 0.3
102 0.3
103 0.32
104 0.34
105 0.31
106 0.29
107 0.23
108 0.24
109 0.24
110 0.24
111 0.28
112 0.25
113 0.21
114 0.21
115 0.2
116 0.18
117 0.15
118 0.15
119 0.11
120 0.1
121 0.09
122 0.08
123 0.08
124 0.07
125 0.06
126 0.05
127 0.04
128 0.04
129 0.05
130 0.08
131 0.13
132 0.14
133 0.15
134 0.17
135 0.23
136 0.25
137 0.29
138 0.29
139 0.29
140 0.34
141 0.37
142 0.37
143 0.34
144 0.33
145 0.28
146 0.25
147 0.23
148 0.19
149 0.18
150 0.18
151 0.19
152 0.2
153 0.2
154 0.2
155 0.18
156 0.18
157 0.15
158 0.14
159 0.11
160 0.08
161 0.08
162 0.09
163 0.09
164 0.06
165 0.08
166 0.07
167 0.07
168 0.08
169 0.1
170 0.16
171 0.2
172 0.29
173 0.31
174 0.4
175 0.5
176 0.57
177 0.65
178 0.7
179 0.76
180 0.78
181 0.84
182 0.85
183 0.85
184 0.85
185 0.87
186 0.87
187 0.86
188 0.81
189 0.81
190 0.78
191 0.75
192 0.73
193 0.74
194 0.72
195 0.67
196 0.68
197 0.62
198 0.58
199 0.57
200 0.5
201 0.39
202 0.37
203 0.32
204 0.32
205 0.33
206 0.34
207 0.34
208 0.43
209 0.52
210 0.55
211 0.61
212 0.65
213 0.72
214 0.76
215 0.81
216 0.83
217 0.85
218 0.86
219 0.9
220 0.91
221 0.92
222 0.94
223 0.95
224 0.95
225 0.92
226 0.91
227 0.9
228 0.9
229 0.89
230 0.84
231 0.83
232 0.76
233 0.69
234 0.58
235 0.5
236 0.39
237 0.28
238 0.23
239 0.13
240 0.09
241 0.08
242 0.08
243 0.05
244 0.06
245 0.06