Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K7F4

Protein Details
Accession A0A5N6K7F4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-55HHNNTTQFNKPKPKPKKKKKKKKKTQRTNQSKKGDEKTBasic
NLS Segment(s)
PositionSequence
27-55KPKPKPKKKKKKKKKTQRTNQSKKGDEKT
Subcellular Location(s) nucl 19.5, mito_nucl 12.5, mito 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKMNLKQWMDYMNESRHHHNNTTQFNKPKPKPKKKKKKKKKTQRTNQSKKGDEKTKERNEPNSTHSKNYLMQAWNGVWETSKQLFVCAADILILCYVICLCYTVRRRWKSLGEHGWMYIVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.49
4 0.51
5 0.49
6 0.5
7 0.53
8 0.56
9 0.58
10 0.61
11 0.6
12 0.63
13 0.7
14 0.71
15 0.73
16 0.74
17 0.8
18 0.83
19 0.88
20 0.92
21 0.92
22 0.97
23 0.97
24 0.97
25 0.97
26 0.97
27 0.97
28 0.97
29 0.97
30 0.97
31 0.97
32 0.96
33 0.95
34 0.92
35 0.86
36 0.82
37 0.79
38 0.76
39 0.7
40 0.67
41 0.67
42 0.67
43 0.69
44 0.65
45 0.64
46 0.6
47 0.58
48 0.55
49 0.54
50 0.48
51 0.42
52 0.4
53 0.35
54 0.32
55 0.31
56 0.31
57 0.22
58 0.21
59 0.21
60 0.19
61 0.18
62 0.17
63 0.15
64 0.1
65 0.09
66 0.14
67 0.13
68 0.15
69 0.14
70 0.14
71 0.15
72 0.14
73 0.15
74 0.11
75 0.09
76 0.07
77 0.08
78 0.08
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.06
88 0.15
89 0.21
90 0.31
91 0.41
92 0.47
93 0.52
94 0.57
95 0.65
96 0.65
97 0.7
98 0.69
99 0.65
100 0.62
101 0.57