Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K3W9

Protein Details
Accession A0A5N6K3W9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-23SLCTERLRRRHSYKSLPTPMLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10plas 10, E.R. 3, cyto 1, extr 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MYSLCTERLRRRHSYKSLPTPMLITLFQSRVGNTICPSIEHCFFIVICSVSILRASYASNAKFVSDAFQSVRWFFIFRICSYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.81
4 0.82
5 0.74
6 0.67
7 0.58
8 0.5
9 0.42
10 0.31
11 0.23
12 0.18
13 0.17
14 0.18
15 0.17
16 0.15
17 0.16
18 0.16
19 0.15
20 0.13
21 0.15
22 0.13
23 0.13
24 0.15
25 0.15
26 0.15
27 0.15
28 0.14
29 0.12
30 0.12
31 0.12
32 0.11
33 0.08
34 0.07
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.09
44 0.14
45 0.15
46 0.17
47 0.16
48 0.16
49 0.16
50 0.16
51 0.16
52 0.12
53 0.13
54 0.13
55 0.17
56 0.19
57 0.19
58 0.21
59 0.19
60 0.19
61 0.17
62 0.23
63 0.23