Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K9Y5

Protein Details
Accession A0A5N6K9Y5   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
100-127YSNPSSMKARSRRRTRISSKRYQIPKLLHydrophilic
NLS Segment(s)
PositionSequence
109-115RSRRRTR
Subcellular Location(s) cyto 12, cyto_nucl 12.5, golg 2, nucl 11
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MSKNTEWISLNRYVVTGEPQNEPTSSILSLVFSCLNVPNFSGIDSIRCLETVRAAEWNLDLLALPHPWFDCTVKVDFRHRYSPVYAHISSQTCRKWYRIYSNPSSMKARSRRRTRISSKRYQIPKLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.21
5 0.23
6 0.25
7 0.27
8 0.26
9 0.26
10 0.22
11 0.19
12 0.17
13 0.14
14 0.12
15 0.11
16 0.11
17 0.11
18 0.1
19 0.08
20 0.09
21 0.11
22 0.12
23 0.12
24 0.12
25 0.12
26 0.12
27 0.12
28 0.13
29 0.1
30 0.1
31 0.11
32 0.11
33 0.09
34 0.09
35 0.09
36 0.08
37 0.11
38 0.11
39 0.1
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.08
46 0.07
47 0.06
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.08
56 0.08
57 0.09
58 0.11
59 0.14
60 0.16
61 0.19
62 0.25
63 0.29
64 0.32
65 0.36
66 0.35
67 0.36
68 0.35
69 0.35
70 0.33
71 0.35
72 0.31
73 0.27
74 0.3
75 0.29
76 0.28
77 0.32
78 0.3
79 0.28
80 0.3
81 0.31
82 0.33
83 0.38
84 0.47
85 0.5
86 0.56
87 0.59
88 0.66
89 0.67
90 0.65
91 0.63
92 0.55
93 0.56
94 0.57
95 0.6
96 0.61
97 0.68
98 0.74
99 0.78
100 0.86
101 0.88
102 0.89
103 0.88
104 0.88
105 0.87
106 0.86
107 0.86
108 0.82