Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KE20

Protein Details
Accession A0A5N6KE20   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-69ISRHLHFHHKEKRKIKNFSQSASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MHRYFIPCLFPVPNPIKTNSKNNRHGKIRKIINKFINITHTSHTVIISRHLHFHHKEKRKIKNFSQSASGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.45
4 0.47
5 0.57
6 0.58
7 0.62
8 0.65
9 0.71
10 0.75
11 0.77
12 0.79
13 0.76
14 0.75
15 0.75
16 0.73
17 0.71
18 0.7
19 0.66
20 0.64
21 0.58
22 0.5
23 0.45
24 0.38
25 0.33
26 0.27
27 0.24
28 0.2
29 0.19
30 0.19
31 0.16
32 0.14
33 0.18
34 0.21
35 0.2
36 0.23
37 0.24
38 0.3
39 0.32
40 0.42
41 0.46
42 0.52
43 0.62
44 0.67
45 0.76
46 0.8
47 0.85
48 0.84
49 0.85
50 0.81
51 0.75