Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K4H1

Protein Details
Accession A0A5N6K4H1    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MHSWKRREERKKLAKANPNGRLGRBasic
NLS Segment(s)
PositionSequence
5-18KRREERKKLAKANP
Subcellular Location(s) cyto 9.5, mito 9, cyto_nucl 7.5, nucl 4.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Pfam View protein in Pfam  
PF13561  adh_short_C2  
Amino Acid Sequences MHSWKRREERKKLAKANPNGRLGRPEDIAGVVVFLASRAGSHVNGANVVVDGGEWLGRGVFGADDEGEEKEKAKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.88
4 0.84
5 0.81
6 0.73
7 0.65
8 0.6
9 0.53
10 0.46
11 0.37
12 0.29
13 0.21
14 0.19
15 0.19
16 0.13
17 0.1
18 0.06
19 0.05
20 0.04
21 0.04
22 0.03
23 0.02
24 0.02
25 0.03
26 0.05
27 0.05
28 0.06
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.06
35 0.06
36 0.05
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.07
52 0.08
53 0.1
54 0.12
55 0.12