Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KG45

Protein Details
Accession A0A5N6KG45    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-31RYLSSRCPTHGNKKESKKGRVPSGGRKKSKBasic
NLS Segment(s)
PositionSequence
14-31KKESKKGRVPSGGRKKSK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRYLSSRCPTHGNKKESKKGRVPSGGRKKSKDIMLVDFELGINPIQLSAVQPNPAQSTSLHSTPTLPSPLRSHLSYTLLYFSLLDPMNFHAIRPIPSHPIPSHPIQIQPESQTRTHCPYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.81
3 0.82
4 0.83
5 0.81
6 0.79
7 0.8
8 0.8
9 0.77
10 0.78
11 0.8
12 0.81
13 0.79
14 0.75
15 0.71
16 0.68
17 0.66
18 0.62
19 0.54
20 0.49
21 0.46
22 0.43
23 0.37
24 0.3
25 0.25
26 0.18
27 0.15
28 0.1
29 0.06
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.07
36 0.08
37 0.1
38 0.1
39 0.11
40 0.13
41 0.13
42 0.13
43 0.11
44 0.15
45 0.17
46 0.17
47 0.17
48 0.15
49 0.16
50 0.16
51 0.18
52 0.16
53 0.13
54 0.15
55 0.16
56 0.2
57 0.22
58 0.22
59 0.23
60 0.22
61 0.24
62 0.23
63 0.22
64 0.19
65 0.16
66 0.16
67 0.14
68 0.11
69 0.13
70 0.12
71 0.11
72 0.1
73 0.12
74 0.18
75 0.17
76 0.17
77 0.17
78 0.18
79 0.21
80 0.23
81 0.24
82 0.25
83 0.26
84 0.33
85 0.29
86 0.33
87 0.35
88 0.36
89 0.39
90 0.34
91 0.39
92 0.37
93 0.4
94 0.38
95 0.39
96 0.42
97 0.41
98 0.41
99 0.41
100 0.42