Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VSK7

Protein Details
Accession H1VSK7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
144-177VVSEKRERRDRDEERERRRRRSRSRSPRRERRRDBasic
NLS Segment(s)
PositionSequence
148-177KRERRDRDEERERRRRRSRSRSPRRERRRD
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019315  MMTA2_N  
IPR039207  MMTAG2-like  
Pfam View protein in Pfam  
PF10159  MMtag  
Amino Acid Sequences MDLLSSVRKSGSRGGVNFSWDEVANSAHRENYLGHSLKAPVGRWQKGRDLNWYAKGDDAAGAREGETEQERAERERKEELRKVKEAEEDALARALGLPVPQRDTSGANAVEVSGIRGIGAVGAATAAGDNPVEEEQQQKKGGLVVSEKRERRDRDEERERRRRRSRSRSPRRERRRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.44
4 0.42
5 0.35
6 0.29
7 0.21
8 0.21
9 0.15
10 0.15
11 0.14
12 0.16
13 0.16
14 0.15
15 0.15
16 0.15
17 0.16
18 0.18
19 0.25
20 0.24
21 0.23
22 0.24
23 0.25
24 0.27
25 0.28
26 0.25
27 0.25
28 0.32
29 0.37
30 0.4
31 0.42
32 0.47
33 0.52
34 0.54
35 0.53
36 0.51
37 0.51
38 0.54
39 0.53
40 0.45
41 0.38
42 0.35
43 0.27
44 0.23
45 0.18
46 0.12
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.08
56 0.1
57 0.11
58 0.14
59 0.19
60 0.18
61 0.2
62 0.27
63 0.32
64 0.38
65 0.44
66 0.49
67 0.51
68 0.53
69 0.52
70 0.47
71 0.45
72 0.38
73 0.33
74 0.26
75 0.2
76 0.17
77 0.15
78 0.12
79 0.08
80 0.07
81 0.06
82 0.04
83 0.05
84 0.06
85 0.07
86 0.1
87 0.1
88 0.11
89 0.12
90 0.14
91 0.14
92 0.17
93 0.16
94 0.14
95 0.13
96 0.13
97 0.12
98 0.1
99 0.09
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.03
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.03
115 0.03
116 0.03
117 0.04
118 0.05
119 0.06
120 0.06
121 0.13
122 0.16
123 0.21
124 0.23
125 0.22
126 0.22
127 0.24
128 0.25
129 0.22
130 0.26
131 0.28
132 0.35
133 0.43
134 0.45
135 0.48
136 0.56
137 0.57
138 0.59
139 0.63
140 0.63
141 0.65
142 0.74
143 0.78
144 0.8
145 0.87
146 0.87
147 0.87
148 0.89
149 0.89
150 0.89
151 0.9
152 0.91
153 0.91
154 0.95
155 0.95
156 0.96
157 0.97