Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K9Z1

Protein Details
Accession A0A5N6K9Z1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-26SPKSPKCAKLARKINRDPAPHydrophilic
43-73IQLTFNMRAKWRKKRVRRLKRKRRKTRARSKBasic
NLS Segment(s)
PositionSequence
50-73RAKWRKKRVRRLKRKRRKTRARSK
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRYHVISPKSPKCAKLARKINRDPAPYLELQSTELIPLLQSFIQLTFNMRAKWRKKRVRRLKRKRRKTRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.67
4 0.68
5 0.74
6 0.79
7 0.82
8 0.79
9 0.74
10 0.65
11 0.59
12 0.53
13 0.44
14 0.38
15 0.29
16 0.22
17 0.2
18 0.18
19 0.14
20 0.1
21 0.09
22 0.07
23 0.06
24 0.06
25 0.05
26 0.04
27 0.05
28 0.05
29 0.05
30 0.07
31 0.07
32 0.09
33 0.13
34 0.16
35 0.17
36 0.21
37 0.3
38 0.37
39 0.48
40 0.56
41 0.63
42 0.71
43 0.81
44 0.88
45 0.91
46 0.94
47 0.95
48 0.96
49 0.96
50 0.97
51 0.97
52 0.97
53 0.97