Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KB69

Protein Details
Accession A0A5N6KB69   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-68AYITNHNLMKKKKKSPPPQKNPHydrophilic
NLS Segment(s)
PositionSequence
56-68KKKKKSPPPQKNP
Subcellular Location(s) E.R. 5, extr 1, golg 1, mito 11, pero 1, plas 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLVVDGIGRAGIYFCICFCICSYIYIISKFLSFPFLPFPSQSIPYIAYITNHNLMKKKKKSPPPQKNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.11
3 0.11
4 0.11
5 0.12
6 0.15
7 0.15
8 0.15
9 0.17
10 0.17
11 0.19
12 0.19
13 0.19
14 0.15
15 0.15
16 0.14
17 0.13
18 0.12
19 0.1
20 0.1
21 0.14
22 0.15
23 0.15
24 0.15
25 0.17
26 0.15
27 0.17
28 0.17
29 0.15
30 0.15
31 0.15
32 0.16
33 0.15
34 0.13
35 0.14
36 0.17
37 0.21
38 0.21
39 0.23
40 0.29
41 0.37
42 0.46
43 0.53
44 0.6
45 0.65
46 0.74
47 0.82
48 0.87