Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K2M7

Protein Details
Accession A0A5N6K2M7   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-79HFTIHLRTKKQKQNKTKRSLVKRKKKAEKRKRKNSYSKVMHVSBasic
NLS Segment(s)
PositionSequence
44-69TKKQKQNKTKRSLVKRKKKAEKRKRK
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MIPPNIMHAYIHPPRTHPFLLVYFPFPKYPCNNQYIHFTIHLRTKKQKQNKTKRSLVKRKKKAEKRKRKNSYSKVMHVSNHSTTQTNHDIVVAADCLPGGIWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.39
4 0.32
5 0.3
6 0.27
7 0.31
8 0.3
9 0.31
10 0.27
11 0.28
12 0.29
13 0.25
14 0.28
15 0.29
16 0.36
17 0.37
18 0.38
19 0.39
20 0.38
21 0.44
22 0.42
23 0.38
24 0.32
25 0.28
26 0.26
27 0.32
28 0.34
29 0.32
30 0.37
31 0.44
32 0.51
33 0.6
34 0.67
35 0.7
36 0.78
37 0.84
38 0.84
39 0.83
40 0.83
41 0.84
42 0.86
43 0.86
44 0.85
45 0.85
46 0.87
47 0.89
48 0.91
49 0.92
50 0.92
51 0.93
52 0.93
53 0.94
54 0.94
55 0.94
56 0.94
57 0.92
58 0.92
59 0.88
60 0.84
61 0.79
62 0.72
63 0.64
64 0.58
65 0.54
66 0.46
67 0.42
68 0.37
69 0.32
70 0.29
71 0.34
72 0.34
73 0.29
74 0.26
75 0.22
76 0.21
77 0.19
78 0.2
79 0.14
80 0.1
81 0.09
82 0.08
83 0.08