Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K4T6

Protein Details
Accession A0A5N6K4T6   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
228-251KISSEEPKKRKTAKPENSAKKAKKBasic
NLS Segment(s)
PositionSequence
136-149RGSGRPSKNSPFRR
193-207KEAAREKERQGAEKR
233-251EPKKRKTAKPENSAKKAKK
Subcellular Location(s) cyto_nucl 11.5, mito 5, nucl 19.5
Family & Domain DBs
Amino Acid Sequences MRSSRRSASQSKDKEITESQQVSVSFPAHTPLKSPLPLVVTDPFLTSGIDAKQETNENGTGDENMASWRAKKVKQQYNSEGDDDENETDSKDVPETEGKPEGKSSKSKENDGDEANELDDKKQDEEIKNANDEGKRGSGRPSKNSPFRRKLTKSDVQSSPVPTRAPAKEYRQGTRSSARQQQISEDAKGEKIKEAAREKERQGAEKRKNEVFDEDDEKFGVQAKPAMKISSEEPKKRKTAKPENSAKKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.52
4 0.51
5 0.46
6 0.38
7 0.37
8 0.36
9 0.33
10 0.3
11 0.27
12 0.18
13 0.16
14 0.2
15 0.18
16 0.18
17 0.19
18 0.23
19 0.27
20 0.28
21 0.28
22 0.27
23 0.27
24 0.27
25 0.28
26 0.24
27 0.22
28 0.21
29 0.21
30 0.18
31 0.16
32 0.16
33 0.13
34 0.13
35 0.11
36 0.14
37 0.13
38 0.13
39 0.16
40 0.18
41 0.19
42 0.19
43 0.2
44 0.17
45 0.18
46 0.17
47 0.15
48 0.13
49 0.12
50 0.09
51 0.08
52 0.1
53 0.09
54 0.1
55 0.15
56 0.2
57 0.23
58 0.3
59 0.4
60 0.48
61 0.56
62 0.63
63 0.65
64 0.67
65 0.67
66 0.6
67 0.5
68 0.41
69 0.34
70 0.27
71 0.2
72 0.14
73 0.11
74 0.1
75 0.1
76 0.1
77 0.09
78 0.08
79 0.07
80 0.08
81 0.12
82 0.14
83 0.17
84 0.22
85 0.22
86 0.22
87 0.25
88 0.26
89 0.25
90 0.29
91 0.3
92 0.34
93 0.36
94 0.39
95 0.41
96 0.42
97 0.42
98 0.38
99 0.36
100 0.27
101 0.24
102 0.21
103 0.18
104 0.14
105 0.11
106 0.11
107 0.1
108 0.1
109 0.12
110 0.16
111 0.16
112 0.2
113 0.24
114 0.23
115 0.23
116 0.23
117 0.23
118 0.19
119 0.19
120 0.17
121 0.15
122 0.15
123 0.15
124 0.21
125 0.25
126 0.28
127 0.34
128 0.4
129 0.45
130 0.54
131 0.63
132 0.66
133 0.68
134 0.7
135 0.73
136 0.7
137 0.7
138 0.7
139 0.67
140 0.63
141 0.63
142 0.6
143 0.53
144 0.51
145 0.48
146 0.41
147 0.36
148 0.31
149 0.24
150 0.28
151 0.26
152 0.27
153 0.29
154 0.33
155 0.38
156 0.41
157 0.45
158 0.42
159 0.43
160 0.43
161 0.44
162 0.43
163 0.43
164 0.48
165 0.47
166 0.47
167 0.45
168 0.44
169 0.46
170 0.43
171 0.37
172 0.31
173 0.28
174 0.28
175 0.29
176 0.27
177 0.2
178 0.2
179 0.22
180 0.28
181 0.34
182 0.39
183 0.44
184 0.5
185 0.5
186 0.55
187 0.54
188 0.54
189 0.57
190 0.59
191 0.62
192 0.64
193 0.67
194 0.64
195 0.64
196 0.59
197 0.55
198 0.48
199 0.44
200 0.42
201 0.37
202 0.33
203 0.31
204 0.28
205 0.23
206 0.23
207 0.19
208 0.14
209 0.18
210 0.19
211 0.24
212 0.26
213 0.27
214 0.23
215 0.24
216 0.28
217 0.33
218 0.41
219 0.45
220 0.5
221 0.56
222 0.65
223 0.72
224 0.75
225 0.75
226 0.77
227 0.78
228 0.82
229 0.86
230 0.88
231 0.89