Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6JUN7

Protein Details
Accession A0A5N6JUN7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-31RQTPYRFVHYCRKIRRKLQKYKIHKSIKNYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRQTPYRFVHYCRKIRRKLQKYKIHKSIKNYLFNGNVIIIIIIIIIITIHQPYNHPPTKSPPYSLYLNVVYPIKSRAKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.83
3 0.88
4 0.88
5 0.89
6 0.9
7 0.9
8 0.9
9 0.91
10 0.91
11 0.9
12 0.83
13 0.79
14 0.79
15 0.76
16 0.74
17 0.65
18 0.59
19 0.5
20 0.46
21 0.4
22 0.29
23 0.21
24 0.13
25 0.1
26 0.06
27 0.04
28 0.03
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.04
37 0.04
38 0.06
39 0.1
40 0.19
41 0.24
42 0.26
43 0.27
44 0.35
45 0.45
46 0.46
47 0.46
48 0.41
49 0.4
50 0.42
51 0.42
52 0.39
53 0.32
54 0.29
55 0.28
56 0.26
57 0.23
58 0.21
59 0.25