Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VVU3

Protein Details
Accession H1VVU3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
66-90QAYRDCKKAWLDRRKEERKKNGAWWHydrophilic
NLS Segment(s)
PositionSequence
79-85RKEERKK
Subcellular Location(s) nucl 8cyto 8cyto_nucl 8, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010625  CHCH  
IPR009069  Cys_alpha_HP_mot_SF  
Pfam View protein in Pfam  
PF06747  CHCH  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSTGNPQQPTTGVSEKVDESYAESKAKFENKAKSEYFDPCQELAQKSIKCLHRNGGDKTMCGDYFQAYRDCKKAWLDRRKEERKKNGAWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.23
5 0.17
6 0.17
7 0.18
8 0.19
9 0.19
10 0.18
11 0.18
12 0.21
13 0.25
14 0.27
15 0.3
16 0.37
17 0.38
18 0.44
19 0.43
20 0.42
21 0.42
22 0.4
23 0.38
24 0.32
25 0.31
26 0.25
27 0.26
28 0.25
29 0.23
30 0.21
31 0.25
32 0.21
33 0.21
34 0.27
35 0.31
36 0.31
37 0.32
38 0.35
39 0.36
40 0.42
41 0.44
42 0.46
43 0.42
44 0.39
45 0.4
46 0.37
47 0.29
48 0.24
49 0.21
50 0.14
51 0.15
52 0.17
53 0.2
54 0.19
55 0.23
56 0.25
57 0.26
58 0.28
59 0.34
60 0.41
61 0.47
62 0.55
63 0.61
64 0.68
65 0.78
66 0.85
67 0.89
68 0.9
69 0.9
70 0.89