Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VSA1

Protein Details
Accession H1VSA1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-125HPYDRRHRGRSPGARHRRRHQHRYHHETSRSKHRRBasic
NLS Segment(s)
PositionSequence
95-125RRHRGRSPGARHRRRHQHRYHHETSRSKHRR
Subcellular Location(s) mito 9, extr 7, plas 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPVIPISGAGSGLTPTRTLTQPLRALLARQVVTTVTATPETTEESASNELSGGAIAGIVIGSIAGFLLLLWIVKSCGMWSRPKDWSEKDHPYDRRHRGRSPGARHRRRHQHRYHHETSRSKHRRPSYEIDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.13
5 0.14
6 0.19
7 0.21
8 0.28
9 0.31
10 0.32
11 0.34
12 0.31
13 0.31
14 0.31
15 0.33
16 0.26
17 0.21
18 0.21
19 0.17
20 0.18
21 0.17
22 0.14
23 0.09
24 0.1
25 0.1
26 0.1
27 0.1
28 0.11
29 0.11
30 0.11
31 0.1
32 0.11
33 0.13
34 0.12
35 0.11
36 0.09
37 0.08
38 0.07
39 0.07
40 0.04
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.01
49 0.01
50 0.01
51 0.01
52 0.01
53 0.01
54 0.01
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.03
62 0.03
63 0.04
64 0.08
65 0.1
66 0.17
67 0.2
68 0.25
69 0.3
70 0.32
71 0.38
72 0.37
73 0.42
74 0.45
75 0.51
76 0.51
77 0.54
78 0.59
79 0.61
80 0.68
81 0.7
82 0.72
83 0.7
84 0.69
85 0.69
86 0.73
87 0.75
88 0.76
89 0.77
90 0.78
91 0.82
92 0.85
93 0.86
94 0.87
95 0.88
96 0.88
97 0.88
98 0.88
99 0.89
100 0.91
101 0.89
102 0.87
103 0.86
104 0.84
105 0.8
106 0.8
107 0.79
108 0.75
109 0.76
110 0.76
111 0.76
112 0.75