Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V2I4

Protein Details
Accession H1V2I4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
408-442DSKDRDGRYRSRDDYRRRDRRARVRQSRDDYNNANBasic
NLS Segment(s)
Subcellular Location(s)
Family & Domain DBs
InterPro View protein in InterPro  
IPR033194  MFAP1  
IPR009730  MFAP1_C  
Pfam View protein in Pfam  
PF06991  MFAP1  
Amino Acid Sequences MPPKRMTANPVKPARYRAGKPAAPEASDSDSDGSDDETNEAETQARAIPPPPKASSAAKIAGNLSKVNLDERRREAQEKENQRIAREKAERLAAEEGFVTEEEEEEEAVDGEGEESSSEEESSSEEEAPRRLMIRPKFIPKNQRNATKEQFGGAKDDDARYAEEEARRKAAADALVEEQIKKDLAARAAGKKHWDDDEASGSDVDTTDDLDPEAELAAWKLRELKRVKRDRDRIAEQEAEYAERERRZNLTXEERDAEDAEKLARQQEEKDAKGKMSYLQKYYHKGAFYSDEAKAYGLDKRDIMGMRIADDIKDRSALPEYLQKRDMTKLGRKGATKYKDLKSEDTGRWGEFDDRRGGGDRRGFNRHDVDERFRPDNDREVNGANAIPLGDRKALDAPKGGRSDGYRDDDSKDRDGRYRSRDDYRRRDRXRARXVRQXSRDDYNXNANATEEVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.63
4 0.63
5 0.64
6 0.61
7 0.6
8 0.64
9 0.58
10 0.5
11 0.48
12 0.42
13 0.37
14 0.35
15 0.33
16 0.25
17 0.21
18 0.2
19 0.18
20 0.17
21 0.13
22 0.12
23 0.12
24 0.11
25 0.13
26 0.13
27 0.13
28 0.12
29 0.1
30 0.11
31 0.13
32 0.14
33 0.14
34 0.18
35 0.23
36 0.27
37 0.34
38 0.35
39 0.35
40 0.38
41 0.42
42 0.42
43 0.42
44 0.42
45 0.37
46 0.36
47 0.35
48 0.34
49 0.31
50 0.27
51 0.22
52 0.2
53 0.19
54 0.24
55 0.28
56 0.3
57 0.35
58 0.4
59 0.46
60 0.49
61 0.52
62 0.51
63 0.53
64 0.58
65 0.61
66 0.62
67 0.62
68 0.59
69 0.58
70 0.61
71 0.54
72 0.54
73 0.5
74 0.46
75 0.43
76 0.47
77 0.45
78 0.4
79 0.41
80 0.31
81 0.26
82 0.23
83 0.19
84 0.14
85 0.14
86 0.11
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.05
105 0.06
106 0.05
107 0.06
108 0.07
109 0.09
110 0.1
111 0.1
112 0.11
113 0.13
114 0.14
115 0.15
116 0.15
117 0.15
118 0.17
119 0.24
120 0.27
121 0.35
122 0.4
123 0.48
124 0.55
125 0.6
126 0.68
127 0.66
128 0.72
129 0.71
130 0.75
131 0.69
132 0.69
133 0.68
134 0.63
135 0.56
136 0.48
137 0.43
138 0.34
139 0.34
140 0.26
141 0.23
142 0.19
143 0.19
144 0.18
145 0.16
146 0.16
147 0.13
148 0.15
149 0.15
150 0.18
151 0.22
152 0.23
153 0.24
154 0.23
155 0.22
156 0.21
157 0.21
158 0.18
159 0.15
160 0.15
161 0.15
162 0.17
163 0.17
164 0.16
165 0.13
166 0.12
167 0.11
168 0.09
169 0.1
170 0.11
171 0.12
172 0.15
173 0.18
174 0.23
175 0.26
176 0.27
177 0.28
178 0.26
179 0.27
180 0.25
181 0.23
182 0.2
183 0.19
184 0.22
185 0.19
186 0.18
187 0.16
188 0.14
189 0.13
190 0.11
191 0.09
192 0.05
193 0.06
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.03
202 0.03
203 0.03
204 0.05
205 0.05
206 0.05
207 0.12
208 0.13
209 0.21
210 0.26
211 0.35
212 0.43
213 0.53
214 0.61
215 0.65
216 0.72
217 0.72
218 0.75
219 0.72
220 0.65
221 0.6
222 0.55
223 0.45
224 0.39
225 0.31
226 0.24
227 0.19
228 0.17
229 0.15
230 0.13
231 0.14
232 0.13
233 0.13
234 0.17
235 0.2
236 0.23
237 0.28
238 0.28
239 0.3
240 0.3
241 0.3
242 0.26
243 0.23
244 0.2
245 0.11
246 0.11
247 0.09
248 0.1
249 0.11
250 0.11
251 0.13
252 0.21
253 0.27
254 0.28
255 0.31
256 0.29
257 0.29
258 0.28
259 0.28
260 0.24
261 0.27
262 0.29
263 0.29
264 0.34
265 0.39
266 0.43
267 0.46
268 0.44
269 0.36
270 0.32
271 0.31
272 0.29
273 0.27
274 0.26
275 0.23
276 0.2
277 0.2
278 0.19
279 0.18
280 0.15
281 0.15
282 0.13
283 0.14
284 0.13
285 0.13
286 0.17
287 0.17
288 0.17
289 0.17
290 0.15
291 0.15
292 0.17
293 0.16
294 0.13
295 0.15
296 0.15
297 0.13
298 0.14
299 0.12
300 0.12
301 0.15
302 0.15
303 0.15
304 0.22
305 0.24
306 0.27
307 0.3
308 0.3
309 0.29
310 0.31
311 0.35
312 0.34
313 0.39
314 0.43
315 0.48
316 0.52
317 0.52
318 0.55
319 0.59
320 0.57
321 0.57
322 0.56
323 0.54
324 0.58
325 0.6
326 0.58
327 0.55
328 0.58
329 0.52
330 0.51
331 0.47
332 0.39
333 0.36
334 0.34
335 0.33
336 0.28
337 0.3
338 0.27
339 0.26
340 0.27
341 0.31
342 0.3
343 0.3
344 0.35
345 0.39
346 0.39
347 0.46
348 0.46
349 0.47
350 0.51
351 0.49
352 0.49
353 0.47
354 0.49
355 0.51
356 0.54
357 0.52
358 0.48
359 0.48
360 0.44
361 0.48
362 0.44
363 0.4
364 0.37
365 0.36
366 0.36
367 0.32
368 0.29
369 0.2
370 0.16
371 0.13
372 0.1
373 0.09
374 0.11
375 0.12
376 0.12
377 0.14
378 0.21
379 0.23
380 0.24
381 0.3
382 0.3
383 0.36
384 0.38
385 0.36
386 0.33
387 0.33
388 0.37
389 0.38
390 0.41
391 0.38
392 0.37
393 0.42
394 0.46
395 0.48
396 0.49
397 0.47
398 0.44
399 0.47
400 0.53
401 0.57
402 0.58
403 0.62
404 0.61
405 0.67
406 0.73
407 0.77
408 0.81
409 0.83
410 0.86
411 0.86
412 0.89
413 0.9
414 0.91
415 0.92
416 0.92
417 0.92
418 0.92
419 0.93
420 0.91
421 0.91
422 0.86
423 0.83
424 0.76
425 0.73
426 0.68
427 0.58
428 0.52