Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W0R3

Protein Details
Accession H1W0R3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-92LPRAPRTPGKQEKGKRKRTVBasic
NLS Segment(s)
PositionSequence
76-90APRTPGKQEKGKRKR
Subcellular Location(s) mito 13, extr 4, nucl 3, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences TNKRASSPLSNSQPFQSPFITPDIIPAFFIWINTVRKAYGSQTSGLLLDPSHGWARTAEESLPLAPQVDCRQLPRAPRTPGKQEKGKRKRTVLGQPKVSTLFFVNWCRLNLRQGACKGYVCFSWVRTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.37
4 0.29
5 0.27
6 0.29
7 0.28
8 0.2
9 0.24
10 0.23
11 0.22
12 0.21
13 0.19
14 0.18
15 0.16
16 0.17
17 0.13
18 0.16
19 0.18
20 0.19
21 0.2
22 0.17
23 0.18
24 0.19
25 0.2
26 0.2
27 0.19
28 0.19
29 0.19
30 0.19
31 0.19
32 0.17
33 0.15
34 0.08
35 0.08
36 0.07
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.12
43 0.13
44 0.13
45 0.11
46 0.11
47 0.11
48 0.11
49 0.11
50 0.08
51 0.07
52 0.06
53 0.08
54 0.09
55 0.12
56 0.13
57 0.15
58 0.19
59 0.21
60 0.26
61 0.32
62 0.37
63 0.39
64 0.45
65 0.48
66 0.54
67 0.61
68 0.62
69 0.64
70 0.65
71 0.71
72 0.75
73 0.8
74 0.78
75 0.74
76 0.74
77 0.74
78 0.77
79 0.76
80 0.74
81 0.72
82 0.65
83 0.62
84 0.58
85 0.5
86 0.4
87 0.31
88 0.27
89 0.23
90 0.26
91 0.27
92 0.27
93 0.28
94 0.3
95 0.3
96 0.31
97 0.33
98 0.34
99 0.38
100 0.39
101 0.42
102 0.41
103 0.42
104 0.39
105 0.35
106 0.31
107 0.26
108 0.25