Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VDA5

Protein Details
Accession H1VDA5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
9-35LRSGQPPPPQQQQHRPFRRKQLREVIPHydrophilic
117-149NTKNKCKECEKMQKCRKCRKKGSSLWNRPKERIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MVDETVVALRSGQPPPXPQQQQHRPFRRKQLREVIPLDDDIVVLDEGVVGGGNGSEGYYYIDYDTDGVWESDWSSDADRSACEECCCYSDIKGSECCNSGTKDCCASGRKKCGAKANNTKNKCKECEKMQKCRKCRKKGSSLWNRPKERIDWGGDVVGFSRRPGEVRTARRGYNLLCPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.49
4 0.55
5 0.59
6 0.68
7 0.73
8 0.78
9 0.83
10 0.85
11 0.83
12 0.85
13 0.88
14 0.83
15 0.83
16 0.82
17 0.8
18 0.79
19 0.75
20 0.67
21 0.58
22 0.51
23 0.43
24 0.32
25 0.23
26 0.15
27 0.13
28 0.08
29 0.06
30 0.06
31 0.04
32 0.04
33 0.04
34 0.04
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.03
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.1
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.12
72 0.12
73 0.1
74 0.09
75 0.13
76 0.14
77 0.15
78 0.18
79 0.18
80 0.19
81 0.19
82 0.2
83 0.18
84 0.18
85 0.18
86 0.17
87 0.18
88 0.18
89 0.17
90 0.2
91 0.22
92 0.27
93 0.33
94 0.39
95 0.44
96 0.46
97 0.49
98 0.55
99 0.57
100 0.61
101 0.64
102 0.67
103 0.7
104 0.72
105 0.76
106 0.75
107 0.75
108 0.7
109 0.66
110 0.61
111 0.62
112 0.68
113 0.69
114 0.71
115 0.75
116 0.8
117 0.83
118 0.87
119 0.87
120 0.87
121 0.89
122 0.88
123 0.89
124 0.89
125 0.91
126 0.91
127 0.92
128 0.92
129 0.91
130 0.86
131 0.79
132 0.74
133 0.65
134 0.61
135 0.56
136 0.5
137 0.43
138 0.4
139 0.38
140 0.34
141 0.31
142 0.25
143 0.23
144 0.17
145 0.14
146 0.15
147 0.13
148 0.15
149 0.17
150 0.26
151 0.32
152 0.39
153 0.49
154 0.52
155 0.53
156 0.55
157 0.56
158 0.49