Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SS05

Protein Details
Accession Q8SS05    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-32GSYPQGNKKGKAKKKSGQNAFARKEWHydrophilic
NLS Segment(s)
PositionSequence
14-22KKGKAKKKS
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027500  Ribosomal_S1/3_euk  
IPR001593  Ribosomal_S3Ae  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ecu:ECU05_0250  -  
Pfam View protein in Pfam  
PF01015  Ribosomal_S3Ae  
Amino Acid Sequences MAIQPPGSYPQGNKKGKAKKKSGQNAFARKEWYTLRSPSIFPNNINGKTLMTKSAGKNSYMNMIGRRYDVNQADLTGNNDVGHRKFIFKIGDIKGSECVGFFDGMELTSDKHKAMIKKWHTLIEAQKDIVAKDGSVFRVFVMGVTRRHPGYVKKTCYVKHSDEKKIRKIMFDVIEEELSGCDVQKIMKKLANETVGKRIEELGSEIFPLQNCCVRKVKTIKSHQTASVGQQEAIDAITN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.72
4 0.78
5 0.78
6 0.75
7 0.81
8 0.86
9 0.86
10 0.85
11 0.86
12 0.86
13 0.81
14 0.77
15 0.7
16 0.59
17 0.54
18 0.48
19 0.42
20 0.37
21 0.36
22 0.38
23 0.37
24 0.37
25 0.4
26 0.46
27 0.44
28 0.39
29 0.44
30 0.46
31 0.44
32 0.45
33 0.38
34 0.31
35 0.31
36 0.31
37 0.25
38 0.2
39 0.24
40 0.25
41 0.34
42 0.34
43 0.32
44 0.33
45 0.31
46 0.33
47 0.3
48 0.3
49 0.24
50 0.25
51 0.24
52 0.24
53 0.24
54 0.21
55 0.25
56 0.25
57 0.24
58 0.22
59 0.22
60 0.22
61 0.21
62 0.21
63 0.15
64 0.14
65 0.11
66 0.12
67 0.13
68 0.12
69 0.16
70 0.14
71 0.15
72 0.16
73 0.2
74 0.21
75 0.2
76 0.27
77 0.25
78 0.31
79 0.29
80 0.29
81 0.26
82 0.25
83 0.23
84 0.15
85 0.14
86 0.09
87 0.08
88 0.07
89 0.06
90 0.06
91 0.06
92 0.07
93 0.06
94 0.06
95 0.07
96 0.08
97 0.08
98 0.1
99 0.13
100 0.15
101 0.2
102 0.29
103 0.33
104 0.38
105 0.4
106 0.41
107 0.39
108 0.4
109 0.4
110 0.36
111 0.33
112 0.26
113 0.26
114 0.23
115 0.22
116 0.21
117 0.16
118 0.09
119 0.09
120 0.11
121 0.11
122 0.11
123 0.11
124 0.09
125 0.09
126 0.09
127 0.08
128 0.1
129 0.12
130 0.14
131 0.16
132 0.18
133 0.17
134 0.18
135 0.2
136 0.23
137 0.3
138 0.38
139 0.41
140 0.44
141 0.49
142 0.5
143 0.53
144 0.53
145 0.5
146 0.5
147 0.54
148 0.58
149 0.63
150 0.69
151 0.71
152 0.74
153 0.68
154 0.61
155 0.55
156 0.52
157 0.47
158 0.41
159 0.36
160 0.29
161 0.27
162 0.25
163 0.22
164 0.15
165 0.11
166 0.09
167 0.07
168 0.05
169 0.05
170 0.08
171 0.13
172 0.16
173 0.2
174 0.22
175 0.24
176 0.27
177 0.34
178 0.38
179 0.37
180 0.37
181 0.42
182 0.42
183 0.41
184 0.38
185 0.33
186 0.27
187 0.24
188 0.24
189 0.17
190 0.14
191 0.15
192 0.15
193 0.14
194 0.15
195 0.16
196 0.16
197 0.19
198 0.2
199 0.24
200 0.31
201 0.32
202 0.41
203 0.48
204 0.55
205 0.6
206 0.7
207 0.76
208 0.75
209 0.77
210 0.71
211 0.68
212 0.61
213 0.56
214 0.54
215 0.45
216 0.38
217 0.33
218 0.3
219 0.25