Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VXW6

Protein Details
Accession H1VXW6    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
163-191CGSWPPPGLSRHKQRRHRQRVTMPSGDRHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, plas 8, extr 4, nucl 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MEARAALPQVADKADGTAMFGKRLWVGAVGVDEEMKELMPAQRRAPREIPYPRKQGPPCTATCRGALGTAAKDGIAPAGSCCSGGERGTSAEASSCLCPLCIWKSSYLAYSVSMITTTIEPSVSVELIQQSLSALRVCVCVCVCFLYHLRPGVTDKSTGSIPCGSWPPPGLSRHKQRRHRQRVTMPSGDRHLFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.14
4 0.18
5 0.18
6 0.18
7 0.18
8 0.18
9 0.18
10 0.19
11 0.17
12 0.12
13 0.11
14 0.11
15 0.12
16 0.11
17 0.1
18 0.1
19 0.09
20 0.08
21 0.08
22 0.06
23 0.05
24 0.06
25 0.1
26 0.17
27 0.2
28 0.25
29 0.31
30 0.34
31 0.41
32 0.44
33 0.44
34 0.46
35 0.55
36 0.58
37 0.6
38 0.66
39 0.64
40 0.69
41 0.67
42 0.66
43 0.62
44 0.58
45 0.54
46 0.54
47 0.55
48 0.47
49 0.45
50 0.38
51 0.31
52 0.26
53 0.23
54 0.17
55 0.13
56 0.12
57 0.11
58 0.09
59 0.08
60 0.08
61 0.07
62 0.05
63 0.05
64 0.04
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.09
76 0.09
77 0.08
78 0.07
79 0.07
80 0.08
81 0.07
82 0.07
83 0.06
84 0.06
85 0.06
86 0.08
87 0.1
88 0.11
89 0.12
90 0.13
91 0.15
92 0.16
93 0.16
94 0.16
95 0.14
96 0.12
97 0.12
98 0.11
99 0.09
100 0.08
101 0.07
102 0.07
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.06
117 0.05
118 0.06
119 0.07
120 0.06
121 0.06
122 0.06
123 0.08
124 0.08
125 0.11
126 0.1
127 0.1
128 0.1
129 0.12
130 0.11
131 0.13
132 0.14
133 0.17
134 0.2
135 0.22
136 0.22
137 0.22
138 0.25
139 0.27
140 0.27
141 0.24
142 0.21
143 0.21
144 0.23
145 0.21
146 0.21
147 0.18
148 0.17
149 0.18
150 0.22
151 0.21
152 0.22
153 0.24
154 0.25
155 0.28
156 0.34
157 0.39
158 0.45
159 0.55
160 0.63
161 0.72
162 0.77
163 0.83
164 0.89
165 0.91
166 0.92
167 0.92
168 0.92
169 0.92
170 0.91
171 0.89
172 0.82
173 0.77
174 0.73