Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W2F9

Protein Details
Accession H1W2F9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-90GSGSRPRNRTGWRRRTRRRRVADAQTRNVGHydrophilic
NLS Segment(s)
PositionSequence
54-81RWRGGRSGSGSRPRNRTGWRRRTRRRRV
Subcellular Location(s) cyto 11.5, cyto_nucl 7.5, plas 4, mito 3, nucl 2.5, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MEHAGHAASPSWLCPFGGWGLERVLVGERVIVVLLVRIGLNLLDGGSGGLRRCRWRGGRSGSGSRPRNRTGWRRRTRRRRVADAQTRNVGRGWRHGLLALFGHHWRVVRTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.16
5 0.15
6 0.14
7 0.15
8 0.15
9 0.15
10 0.14
11 0.14
12 0.11
13 0.1
14 0.09
15 0.08
16 0.07
17 0.07
18 0.06
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.07
37 0.09
38 0.12
39 0.13
40 0.19
41 0.24
42 0.27
43 0.34
44 0.39
45 0.45
46 0.47
47 0.52
48 0.52
49 0.57
50 0.6
51 0.57
52 0.56
53 0.51
54 0.52
55 0.53
56 0.58
57 0.6
58 0.64
59 0.7
60 0.75
61 0.84
62 0.89
63 0.93
64 0.93
65 0.91
66 0.89
67 0.88
68 0.88
69 0.88
70 0.86
71 0.81
72 0.78
73 0.69
74 0.6
75 0.53
76 0.46
77 0.37
78 0.35
79 0.36
80 0.3
81 0.3
82 0.31
83 0.3
84 0.28
85 0.28
86 0.22
87 0.18
88 0.17
89 0.19
90 0.18
91 0.19