Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VLE1

Protein Details
Accession H1VLE1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-46GDSKEWSRLKRHKRPRAPAATIFHydrophilic
NLS Segment(s)
PositionSequence
31-39RLKRHKRPR
Subcellular Location(s) nucl 15, mito_nucl 12.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences TRHGIWTHKEPNLTCHYRDKTDSGDSKEWSRLKRHKRPRAPAATIFCRPFTHIHPQVLLTAQSACGWTSVTHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.48
4 0.47
5 0.49
6 0.45
7 0.4
8 0.44
9 0.46
10 0.43
11 0.43
12 0.4
13 0.4
14 0.44
15 0.44
16 0.39
17 0.43
18 0.45
19 0.51
20 0.6
21 0.69
22 0.72
23 0.78
24 0.84
25 0.85
26 0.85
27 0.8
28 0.77
29 0.73
30 0.68
31 0.62
32 0.55
33 0.46
34 0.37
35 0.34
36 0.3
37 0.27
38 0.32
39 0.34
40 0.34
41 0.34
42 0.34
43 0.34
44 0.33
45 0.29
46 0.19
47 0.14
48 0.13
49 0.12
50 0.12
51 0.11
52 0.09
53 0.1