Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VAJ5

Protein Details
Accession H1VAJ5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
88-112DQSLTPPGRRSRRRNAIRDRHNGYLHydrophilic
NLS Segment(s)
PositionSequence
99-99R
Subcellular Location(s) nucl 14.5, cyto_nucl 8.5, plas 6, golg 2, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MSHSSQNTRSGALTRSTRDDTTMTRTRRTYSPSSRSRSSSAGPRGSHHHRRPSIKTAAVFIAAVAVASLCVHKLWPRGTSHSKKQDWDQSLTPPGRRSRRRNAIRDRHNGYLDYDDHNVFDRXDYYRPHDNVARGALPRGRGESYYPPRVRGGDGRSRGXGSDSDGDSYYSDDYLPSPSERFSGRRGXIEGGADRRGRSRGFGGADEENEVVRYEKQSNRSEADRSRFEEERPERPRYNEAVEDWSRRGGQRYPSPSEERGYRGEPDYVDRRSRRRSDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.41
4 0.39
5 0.39
6 0.38
7 0.35
8 0.38
9 0.43
10 0.4
11 0.42
12 0.44
13 0.46
14 0.48
15 0.51
16 0.53
17 0.54
18 0.61
19 0.64
20 0.69
21 0.7
22 0.69
23 0.65
24 0.6
25 0.54
26 0.54
27 0.53
28 0.53
29 0.49
30 0.48
31 0.52
32 0.57
33 0.63
34 0.61
35 0.63
36 0.64
37 0.7
38 0.75
39 0.75
40 0.73
41 0.67
42 0.61
43 0.53
44 0.47
45 0.39
46 0.32
47 0.24
48 0.17
49 0.11
50 0.09
51 0.06
52 0.04
53 0.03
54 0.04
55 0.04
56 0.03
57 0.04
58 0.05
59 0.08
60 0.13
61 0.16
62 0.2
63 0.24
64 0.31
65 0.41
66 0.49
67 0.56
68 0.61
69 0.62
70 0.6
71 0.63
72 0.65
73 0.59
74 0.56
75 0.49
76 0.43
77 0.47
78 0.47
79 0.43
80 0.39
81 0.42
82 0.47
83 0.54
84 0.58
85 0.61
86 0.69
87 0.76
88 0.81
89 0.84
90 0.85
91 0.85
92 0.86
93 0.8
94 0.74
95 0.66
96 0.57
97 0.47
98 0.4
99 0.32
100 0.26
101 0.23
102 0.18
103 0.17
104 0.17
105 0.16
106 0.12
107 0.12
108 0.11
109 0.1
110 0.13
111 0.17
112 0.19
113 0.19
114 0.21
115 0.24
116 0.23
117 0.24
118 0.23
119 0.21
120 0.18
121 0.19
122 0.19
123 0.16
124 0.15
125 0.16
126 0.14
127 0.13
128 0.15
129 0.23
130 0.27
131 0.35
132 0.35
133 0.35
134 0.35
135 0.36
136 0.35
137 0.31
138 0.31
139 0.3
140 0.32
141 0.33
142 0.32
143 0.32
144 0.3
145 0.26
146 0.2
147 0.13
148 0.12
149 0.11
150 0.11
151 0.11
152 0.1
153 0.11
154 0.1
155 0.09
156 0.07
157 0.06
158 0.06
159 0.08
160 0.09
161 0.09
162 0.1
163 0.1
164 0.12
165 0.14
166 0.15
167 0.17
168 0.24
169 0.24
170 0.25
171 0.26
172 0.25
173 0.27
174 0.3
175 0.3
176 0.28
177 0.29
178 0.27
179 0.28
180 0.31
181 0.27
182 0.24
183 0.24
184 0.22
185 0.23
186 0.24
187 0.25
188 0.24
189 0.24
190 0.24
191 0.21
192 0.16
193 0.14
194 0.13
195 0.11
196 0.1
197 0.13
198 0.17
199 0.21
200 0.29
201 0.34
202 0.38
203 0.41
204 0.43
205 0.47
206 0.48
207 0.51
208 0.48
209 0.47
210 0.48
211 0.46
212 0.44
213 0.48
214 0.46
215 0.49
216 0.49
217 0.53
218 0.5
219 0.53
220 0.58
221 0.52
222 0.53
223 0.47
224 0.44
225 0.45
226 0.46
227 0.46
228 0.41
229 0.4
230 0.36
231 0.33
232 0.35
233 0.32
234 0.37
235 0.42
236 0.48
237 0.52
238 0.56
239 0.61
240 0.59
241 0.59
242 0.54
243 0.48
244 0.46
245 0.42
246 0.4
247 0.36
248 0.37
249 0.33
250 0.36
251 0.39
252 0.4
253 0.46
254 0.49
255 0.55
256 0.62