Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1V9K7

Protein Details
Accession H1V9K7    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
176-204LLLHEVRKLPNNKKRRRRTSPHRDLSRLSHydrophilic
NLS Segment(s)
PositionSequence
183-195KLPNNKKRRRRTS
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MPDDTVIKLRGRNNYEPWNRNLIGLLDLTKDQTAMLAAATSQQPAVGHDRFSKWYQNKCHVYNILTKSLDDVVLSGLGAHGKLHATPWELYETIRTYCKPTPAESIELMDRLRDTKISDSPTPAEFVAYVEFIRVSVEGDSYSMALTWLLFNTVDKTHPYLITEHGPVQSATDWTLLLHEVRKLPNNKKRRRRTSPHRDLSRLSLQSSESSGNEEESEERDDNVEGEDSDEGEDGVEGEDGVEGEDEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.68
4 0.67
5 0.67
6 0.6
7 0.53
8 0.48
9 0.38
10 0.3
11 0.25
12 0.22
13 0.15
14 0.15
15 0.16
16 0.14
17 0.13
18 0.11
19 0.1
20 0.09
21 0.07
22 0.07
23 0.05
24 0.05
25 0.08
26 0.09
27 0.09
28 0.08
29 0.09
30 0.09
31 0.11
32 0.18
33 0.16
34 0.18
35 0.21
36 0.25
37 0.28
38 0.31
39 0.38
40 0.39
41 0.46
42 0.51
43 0.58
44 0.62
45 0.6
46 0.65
47 0.58
48 0.54
49 0.54
50 0.51
51 0.47
52 0.41
53 0.38
54 0.33
55 0.3
56 0.27
57 0.18
58 0.14
59 0.08
60 0.08
61 0.07
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.05
69 0.05
70 0.06
71 0.08
72 0.1
73 0.11
74 0.12
75 0.14
76 0.14
77 0.14
78 0.16
79 0.16
80 0.15
81 0.17
82 0.16
83 0.18
84 0.2
85 0.26
86 0.25
87 0.25
88 0.3
89 0.3
90 0.33
91 0.28
92 0.28
93 0.23
94 0.22
95 0.2
96 0.14
97 0.11
98 0.09
99 0.09
100 0.08
101 0.09
102 0.11
103 0.15
104 0.19
105 0.19
106 0.2
107 0.22
108 0.22
109 0.22
110 0.18
111 0.15
112 0.1
113 0.1
114 0.08
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.04
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.07
140 0.08
141 0.09
142 0.1
143 0.13
144 0.14
145 0.15
146 0.16
147 0.15
148 0.17
149 0.19
150 0.19
151 0.18
152 0.17
153 0.17
154 0.16
155 0.16
156 0.14
157 0.11
158 0.11
159 0.1
160 0.09
161 0.08
162 0.09
163 0.08
164 0.09
165 0.1
166 0.11
167 0.14
168 0.17
169 0.24
170 0.32
171 0.41
172 0.49
173 0.59
174 0.67
175 0.75
176 0.83
177 0.86
178 0.89
179 0.9
180 0.92
181 0.93
182 0.94
183 0.94
184 0.91
185 0.85
186 0.77
187 0.73
188 0.71
189 0.62
190 0.51
191 0.43
192 0.35
193 0.32
194 0.32
195 0.27
196 0.18
197 0.19
198 0.18
199 0.17
200 0.16
201 0.16
202 0.15
203 0.15
204 0.2
205 0.17
206 0.17
207 0.17
208 0.17
209 0.16
210 0.17
211 0.15
212 0.1
213 0.11
214 0.11
215 0.1
216 0.11
217 0.1
218 0.08
219 0.07
220 0.07
221 0.06
222 0.06
223 0.06
224 0.05
225 0.05
226 0.05
227 0.05
228 0.06